KEGG   Mycobacterium sp. JDM601: JDM601_1178Help
Entry
JDM601_1178       CDS       T01512                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase DapE
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mjd01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mjd00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1254566..1255642
Genome map
AA seq 358 aa AA seqDB search
MLDLRSDPIALTAALVDIPSESRHEARIADEVEAALRAQTSGFEIIRDGDAVLARTRLGR
PTRVLLAGHLDTVPAAGNLPSRRTTEAEGDVLHGCGTVDMKSGDAVFLHLAATIAEPAHD
LTCVFYDCEEIDAAANGLNRIERNLPDWLVADLAILGEPTGGFIEAGCQGTLRVVVTAGG
TRAHSARSWLGDNAIHKLGAVLDRLATYRPRSVDIDGCVYREGLSAVRIDGGVAGNVIPD
AASVTVNFRFAPDRSPEQALTHVREVFDGLDVAIEQTDVAAGALPGLTAPAAAALVAAAD
GQVRAKYGWTDVSRFAARGVPAVNYGPGDPNLAHCVDERVPVSQISAVTDLLRRFLVG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacctgcgctccgacccgatcgcgctgaccgcggcgctggtcgacatccccagt
gaatcgcggcacgaggcacgaatcgccgacgaggtggaagccgcgctacgggcccaaacc
tccggcttcgagatcatccgcgacggcgacgcggtactggctcgtacccggctggggcga
ccgactcgggtgctgctggccgggcatctggacaccgtcccggcggccggcaatctgccc
agccgccgcaccaccgaggcggaaggtgatgtcctgcacggctgcggcaccgtcgacatg
aaatccggcgacgccgtcttcctgcacctggcagccaccatcgccgaaccggcacacgac
ttgacctgcgtcttctacgactgtgaggaaatcgacgcggccgccaacgggctgaaccgc
atcgaacgcaacctgccggattggctggtggccgacctcgccatcctcggtgagcccacc
ggcggctttatcgaggccggctgtcagggcacgttgcgggtcgtcgtgaccgccggcggc
acccgggcgcattcggcgcggtcctggctgggcgacaacgccatccacaaactgggcgcg
gtgctggaccggctcgccacctaccggccgcgcagcgtcgacatcgacggctgcgtctac
cgcgagggactctcggcggtgcgtatcgacggcggagtggccggcaacgtgattccggac
gcggccagtgtcacggtgaacttccgcttcgcgccggaccgctcgcccgagcaggcgctg
acccatgtgcgggaggtcttcgacgggctcgacgtcgcgatcgaacagaccgacgtcgcc
gccggcgccctgcccgggctcaccgcgcccgcggcggccgccttggtggccgccgccgac
ggacaggtgcgcgccaagtacggctggaccgacgtctcgcggttcgctgcccgcggcgtt
cccgcggtcaactacgggcccggcgaccccaacctggcgcactgcgtcgacgagcgggtg
ccggtctcccagatcagcgcggtgaccgacctgctgcgccggttcctcgtcggttag

DBGET integrated database retrieval system