KEGG   Mycobacterium sp. JDM601: JDM601_1182Help
Entry
JDM601_1182       CDS       T01512                                 

Gene name
folP2
Definition
dihydropteroate synthase 2 FolP2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mjd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1260380..1261228
Genome map
AA seq 282 aa AA seqDB search
MAADRALIMAIINRTPDSFYDAGATFDDDAAKSAVHQAVADGADVIDIGGVKAGPGQTVD
ADAETARVVPFIEWLRGAYPDQLISVDTWRSEVAKRACVAGADLINDTWGGVDPQLPAVA
AEFGVGLVCSHTGGAAPRTRPFRVSYGTTVDGVVDAVIDEVTAAAQRAVAAGVPREKVLI
DPTHDFGKNTFHGLALLRHTERLVATGWPVLMALSNKDFIGETLGVGLTERLEGTLAATA
LAAAAGARMFRVHEVGPTRRVLEMVASIQGVRAPTRTVRGLA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtggcggccgatcgcgcgctgatcatggcgatcatcaaccgcacccccgactccttctac
gacgccggcgccaccttcgacgacgacgcggctaagtcggcggtgcaccaggcggtggcc
gacggggcggacgtcatcgacatcggcggggtcaaggccgggccggggcagaccgtcgac
gccgatgccgagaccgcccgggtggttcccttcatcgagtggctgcgcggcgcctacccc
gaccagctgatcagtgtcgacacctggcgctcggaggtggcaaaacgcgcctgcgtcgcg
ggcgccgacctgatcaacgacacctggggtggtgtcgacccgcagctgccggcggtcgcc
gcggagttcggtgtcggcctggtctgctcgcacaccggcggcgccgcgccgcggacccgc
ccgttccgggtgagctacggcaccaccgtggacggggtggtggacgcggtgatcgacgag
gtcaccgcggccgcgcagcgggcggtggcggccggggtgccgcgcgagaaggtgctgatc
gacccgacccacgatttcggcaagaacaccttccacgggctagcgttgttgcgacacacg
gagaggctggtcgctaccggatggccggtgctgatggcgctctccaacaaggacttcatc
ggggagactctcggtgtgggtctgaccgaacgactggagggaacgttggcggccaccgca
ctggcggcggccgcgggagcccggatgttccgggtgcacgaggtcgggccgacccggcgc
gtcctggagatggtggcatccatccagggcgtgcgggccccgacccgcacagtaaggggt
ttagcatga

DBGET integrated database retrieval system