KEGG   Mycobacterium sinense: JDM601_1294Help
Entry
JDM601_1294       CDS       T01512                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mjd  Mycobacterium sinense
Pathway
mjd00260  Glycine, serine and threonine metabolism
mjd00750  Vitamin B6 metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01230  Biosynthesis of amino acids
Module
mjd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JDM601_1294 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    JDM601_1294 (thrC)
Enzymes [BR:mjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     JDM601_1294 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEF35294
UniProt: F5YWK7
Position
1378756..1379838
Genome map
AA seq 360 aa AA seqDB search
MSSTRTAVHQPWPGLIGAYRDRLPVGDDWTPITLHEGGTPLIHAKRISEQLGCTVHLKVE
GLNPTGSFKDRGMTMAVTDAVARGQQVVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMATDFPTISLVNSVNPVRIEGQKTAAFEI
VDALGTAPDVHSLPVGNAGNITAYWKGYREYYADGLTDKLPKMLGTQAAGAAPLVLGEPV
KNPETIATAIRIGSPASWTQAVEAQVDSGGRFLAATDEEILAAYHLVAESEGVFVEPASA
ASIAGLLKSVEDGWVPRGSTVVCTVTGNGLKDPDTALRDLPEVTAVPVDAATVVAELGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccacccgcacggcggtccaccagccctggcccggcctgatcggcgcctaccgc
gaccggcttcccgtcggcgacgactggacaccgatcacgctgcacgagggcggcaccccg
ctgatccacgccaagcggatctccgaacagctcggctgcacggtgcacctcaaggtggag
gggctcaaccccaccggttcgttcaaggaccgcggcatgacgatggcggtcaccgacgcg
gtggcccgcggccagcaggtggtgctgtgcgcctcgaccggcaacacctcggcgtcggcg
gcggcctacgccgcgcgggccggcatcacctgcgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcgcaggcggtcatgcacggcgccaagatcatccagatcgacggc
aacttcgacgactgcctggagctggcccgcaagatggccaccgacttcccgaccatctcg
ctagtgaactcggtgaacccggtgcgcatcgagggccagaagaccgcggcgttcgagatc
gtcgacgcgctgggcaccgcgccggacgtccactcgctgccggtcggcaacgccggcaat
atcaccgcctactggaagggctaccgcgagtattacgccgacggcctgaccgacaagctg
cccaagatgctcgggacgcaggccgcgggcgcggcgccgctggtactcggtgagccggtc
aagaaccccgagaccatcgccaccgccatccgcatcggctcgccggcatcctggacccag
gccgtcgaagcgcaggtggattccggtgggcggttcctggccgccaccgacgaggagatc
ctggccgcctaccacctggtggccgagtccgagggtgtcttcgtggagccggcgtcggcg
gccagcatcgccgggctgctcaagtcagtcgaagacggctgggtgccgcgcggttcgacg
gtggtgtgcaccgtcaccggaaacgggctcaaggaccccgacaccgcgctgcgggatctg
cccgaggtcaccgcggttcccgtcgacgcggccaccgtggtcgccgagttggggctggcc
tag

DBGET integrated database retrieval system