KEGG   Mycobacterium sp. JDM601: JDM601_1321Help
Entry
JDM601_1321       CDS       T01512                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JDM601_1321
   00330 Arginine and proline metabolism
    JDM601_1321
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    JDM601_1321
Enzymes [BR:mjd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     JDM601_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1411015..1412289
Genome map
AA seq 424 aa AA seqDB search
MAALVQRYLDGILAEHAEVNVGALASYIPELARVDPTGFGLSLSSSDGYVYESGDAEAQF
TMQSISKPFTYALALDQLGHADVDARIGVEPSGEGFNRISVDQVTQVPKNPMINAGAIVA
CSLIPGATADDRFALVREFYSACAGRGLDFDEDVYRSEKASGSRNRGIAYLLDSFGALDA
DPDDALDVYIRQCSLKVTSTDLARMAATLARGGYNPLTGRQVTDAAVVRRTLSVMVTCGM
YDAAGEWVSAVGMPAKSGVGGGIVAVLPGQLGIGVYSPRIDAKGNSVRGVLVCRSLSQQL
GLHFLTVSSEAHSAIRGMYTPRPGVRVYEVHGDLLFAGAEQVARTATGDCGDFGVAILDV
SRLHAISDPARALLAGLAHELQSLGKRGLLVDPGGALTSDPATRGTLVFATVDDALAASE
KWVT
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcactggtgcagcggtacttggacgggatactcgccgagcatgccgaggtgaac
gtcggtgccctggccagctacattccggagttggcgcgggtcgacccgaccggcttcggt
ctgtcgctgtcgtcgtcggacggctatgtctatgaatccggcgacgccgaggcgcagttc
accatgcagtcgatctccaagccgttcacctacgcgctggcgctcgaccagttggggcat
gcggacgtcgacgcgaggatcggggtggaaccctccggcgagggattcaacaggatcagc
gtcgaccaggtcacccaggtgccgaagaatccgatgatcaacgccggtgcgatagtggcc
tgctcgttgattccgggcgcgaccgccgacgaccgattcgctttggtcagggagttctac
agtgcctgtgcgggacgcggtctggacttcgacgaggacgtctaccggtcggagaaggcc
agcggcagtcgtaatcgcgggatcgcttacctgctggacagtttcggtgctcttgacgct
gaccctgatgacgctctcgacgtctacatccggcagtgctcgttgaaggtcaccagcacc
gatctggcccggatggcggcgacgctcgcgcggggtggttacaacccgttgaccgggcgg
caggtgaccgacgcggcggtggtccggcgcacgctgtcggtcatggtgacctgcggtatg
tacgacgccgccggcgagtgggtcagtgcggtcggtatgccggccaagagcggtgtgggt
ggcggcatcgtggcggtgctgcccggccagctgggcatcggcgtctattcgccgcggatc
gacgccaagggcaacagtgtgcgcggagtgctggtgtgccgcagcctttctcaacagctc
ggcctgcatttcctgaccgtgagcagcgaagctcattcggctattcgcggcatgtacaca
ccccgtccgggcgtccgggtttacgaggtgcacggcgacctgctcttcgccggcgccgaa
caggtggcccgcaccgccaccggcgactgcggcgacttcggcgtcgcgatcctcgacgtg
tcgcgcctgcacgccatcagcgacccggcgcgtgccctgctcgccggactggcccacgag
ctgcagagcctgggcaaacggggccttctcgtcgatccgggcggcgcgctgacgtccgac
ccggcgacccgggggacgctggtgttcgccacggtcgacgacgccctcgccgcgagcgag
aagtgggtgacctag

DBGET integrated database retrieval system