KEGG   Mycolicibacter sinensis: JDM601_1321Help
Entry
JDM601_1321       CDS       T01512                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00220  Arginine biosynthesis
mjd00250  Alanine, aspartate and glutamate metabolism
mjd00471  D-Glutamine and D-glutamate metabolism
mjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JDM601_1321
   00220 Arginine biosynthesis
    JDM601_1321
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    JDM601_1321
Enzymes [BR:mjd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     JDM601_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AEF35321
UniProt: F5YWN4
Position
1411015..1412289
Genome map
AA seq 424 aa AA seqDB search
MAALVQRYLDGILAEHAEVNVGALASYIPELARVDPTGFGLSLSSSDGYVYESGDAEAQF
TMQSISKPFTYALALDQLGHADVDARIGVEPSGEGFNRISVDQVTQVPKNPMINAGAIVA
CSLIPGATADDRFALVREFYSACAGRGLDFDEDVYRSEKASGSRNRGIAYLLDSFGALDA
DPDDALDVYIRQCSLKVTSTDLARMAATLARGGYNPLTGRQVTDAAVVRRTLSVMVTCGM
YDAAGEWVSAVGMPAKSGVGGGIVAVLPGQLGIGVYSPRIDAKGNSVRGVLVCRSLSQQL
GLHFLTVSSEAHSAIRGMYTPRPGVRVYEVHGDLLFAGAEQVARTATGDCGDFGVAILDV
SRLHAISDPARALLAGLAHELQSLGKRGLLVDPGGALTSDPATRGTLVFATVDDALAASE
KWVT
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcactggtgcagcggtacttggacgggatactcgccgagcatgccgaggtgaac
gtcggtgccctggccagctacattccggagttggcgcgggtcgacccgaccggcttcggt
ctgtcgctgtcgtcgtcggacggctatgtctatgaatccggcgacgccgaggcgcagttc
accatgcagtcgatctccaagccgttcacctacgcgctggcgctcgaccagttggggcat
gcggacgtcgacgcgaggatcggggtggaaccctccggcgagggattcaacaggatcagc
gtcgaccaggtcacccaggtgccgaagaatccgatgatcaacgccggtgcgatagtggcc
tgctcgttgattccgggcgcgaccgccgacgaccgattcgctttggtcagggagttctac
agtgcctgtgcgggacgcggtctggacttcgacgaggacgtctaccggtcggagaaggcc
agcggcagtcgtaatcgcgggatcgcttacctgctggacagtttcggtgctcttgacgct
gaccctgatgacgctctcgacgtctacatccggcagtgctcgttgaaggtcaccagcacc
gatctggcccggatggcggcgacgctcgcgcggggtggttacaacccgttgaccgggcgg
caggtgaccgacgcggcggtggtccggcgcacgctgtcggtcatggtgacctgcggtatg
tacgacgccgccggcgagtgggtcagtgcggtcggtatgccggccaagagcggtgtgggt
ggcggcatcgtggcggtgctgcccggccagctgggcatcggcgtctattcgccgcggatc
gacgccaagggcaacagtgtgcgcggagtgctggtgtgccgcagcctttctcaacagctc
ggcctgcatttcctgaccgtgagcagcgaagctcattcggctattcgcggcatgtacaca
ccccgtccgggcgtccgggtttacgaggtgcacggcgacctgctcttcgccggcgccgaa
caggtggcccgcaccgccaccggcgactgcggcgacttcggcgtcgcgatcctcgacgtg
tcgcgcctgcacgccatcagcgacccggcgcgtgccctgctcgccggactggcccacgag
ctgcagagcctgggcaaacggggccttctcgtcgatccgggcggcgcgctgacgtccgac
ccggcgacccgggggacgctggtgttcgccacggtcgacgacgccctcgccgcgagcgag
aagtgggtgacctag

DBGET integrated database retrieval system