KEGG   Mycobacterium sp. JDM601: JDM601_1478Help
Entry
JDM601_1478       CDS       T01512                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JDM601_1478
Enzymes [BR:mjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     JDM601_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1590627..1591487)
Genome map
AA seq 286 aa AA seqDB search
MVAQLCVVGSVNLDTVFTVAALPAPGETVLSSAPSSHPGGKGANQAVAAARAGADVSFIG
AVGNDDAGLRLRRHLRDNGVGTDGLTTVAGPSGSAVVTVDPAGENTIVVAPGANGALTLD
SDQRELITKAQVVLLQLEIPVTTAITAARAARRVGATVIVNVSPVGEDLTELAGLIDVAV
VNETESARFSHPVPHRVVTLGARGARYSGADGIVEVPAPVVAAIDTSGAGDVFAGVLAAE
WPSGKAHALRLACAAGALATLVSGAGDCAPTAEAIRAALATGQPGG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgcagctgtgcgtggtgggcagtgtgaatctggataccgtgttcacggtggct
gcgctgcccgcccccggcgagacggtcctcagctcggcgccgagtagccaccccggcggc
aagggtgccaaccaggcggtggcagccgcgcgcgccggcgccgacgtctcgttcatcggc
gcggtgggtaacgacgacgccggtctgcggttacgccggcacctacgagacaacggcgtc
ggcaccgacggattgacgaccgtcgcgggtcccagcggatcggcggtcgtcacggtggat
ccggccggcgagaacaccatcgtggtggcgccgggggccaacggcgcgctgacgctggac
tccgaccagcgtgagctgattaccaaggcgcaagtggtgctgctgcagctggagattccg
gtcacgacggccatcacggcggcccgagcggcccgccgggtgggggcgaccgtgatcgtc
aatgtctccccggtcggtgaagacctgaccgagttggcggggctgatcgatgtggcggtc
gtcaatgagacggaatcagcgcggttcagccatccggtaccgcatcgggtggtcacgctc
ggagcgcgcggcgcccgctacagcggggctgatggcatcgtcgaggtaccggctccggtg
gtggccgctatcgacacctccggtgccggcgatgtcttcgccggcgtgctggcagccgag
tggcccagcggcaaggcacatgcgctgcggctcgcctgtgcggccggggcgctggcgacg
ttggtttccggcgccggagattgcgccccgaccgccgaagcgatccgtgcggcgctggcg
accggccaaccgggtggctga

DBGET integrated database retrieval system