KEGG   Mycobacterium sinense: JDM601_1489Help
Entry
JDM601_1489       CDS       T01512                                 

Gene name
gpm_1
Definition
(GenBank) phosphoglycerate mutase Gpm_1
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
mjd  Mycobacterium sinense
Brite
Enzymes [BR:mjd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     JDM601_1489 (gpm_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1609567..1610247
Genome map
AA seq 226 aa AA seqDB search
MRVRRLILLRHGQTEFNAGSRMQGQLDTVLSDLGRAQAEAAAEVLRKRHPLLIVSSDLWR
AYDTATVLAEHNGLPVRVDTRLRETHLGDWQGLTHEEVDAAAPGARLAWRDDARWAPHGG
ESRVDVAARSEPLVAELVAGEPAWGSADEADRPAVLVAHGGLIAALTAALLRLPVENWPA
LGGMANASWTQLSGYSDDSGGADDFADVRWRLDVWNASAQVAGDVL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgagggtccggcggctgatcctgttacggcacggccagaccgagttcaacgccggcagc
cgcatgcaaggccagctggacaccgtcctgagcgacctcggtcgcgcgcaggcggaagcg
gcggccgaggtgttgcgcaagcgccacccgttgctgatcgtgtcgtcggatctgtggcgc
gcctacgacaccgccacggtgctggccgagcacaacgggctgccggtccgggtcgacacg
cggttgcgcgaaacgcacctgggtgactggcaggggctgacccacgaagaggtcgacgcc
gcggcaccgggtgcgcggttggcgtggcgcgatgatgcccggtgggctccgcacggcggg
gagagcagggtggacgtggccgcgcgcagcgaaccgctggtcgccgagttggtggccggt
gagccggcctgggggagcgccgacgaggcggaccggccggcggtgctcgtcgcccacggc
ggcctgatcgctgcgctgaccgctgcgctgctgcgtcttccggtcgagaactggccggcg
ctgggcgggatggccaacgccagttggacccagctcagcgggtattccgacgattccggc
ggagctgacgacttcgctgacgtgcgttggcgtctcgatgtctggaacgcttcagcgcag
gtggccggcgatgtcctctga

DBGET integrated database retrieval system