KEGG   Mycobacterium sp. JDM601: JDM601_1489Help
Entry
JDM601_1489       CDS       T01512                                 

Gene name
gpm_1
Definition
(RefSeq) phosphoglycerate mutase Gpm
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_1489 (gpm_1)
   01230 Biosynthesis of amino acids
    JDM601_1489 (gpm_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_1489 (gpm_1)
  Energy metabolism
   00680 Methane metabolism
    JDM601_1489 (gpm_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JDM601_1489 (gpm_1)
Enzymes [BR:mjd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     JDM601_1489 (gpm_1)
Exosome [BR:mjd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   JDM601_1489 (gpm_1)
  Exosomal proteins of melanoma cells
   JDM601_1489 (gpm_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1609567..1610247
Genome map
AA seq 226 aa AA seqDB search
MRVRRLILLRHGQTEFNAGSRMQGQLDTVLSDLGRAQAEAAAEVLRKRHPLLIVSSDLWR
AYDTATVLAEHNGLPVRVDTRLRETHLGDWQGLTHEEVDAAAPGARLAWRDDARWAPHGG
ESRVDVAARSEPLVAELVAGEPAWGSADEADRPAVLVAHGGLIAALTAALLRLPVENWPA
LGGMANASWTQLSGYSDDSGGADDFADVRWRLDVWNASAQVAGDVL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgagggtccggcggctgatcctgttacggcacggccagaccgagttcaacgccggcagc
cgcatgcaaggccagctggacaccgtcctgagcgacctcggtcgcgcgcaggcggaagcg
gcggccgaggtgttgcgcaagcgccacccgttgctgatcgtgtcgtcggatctgtggcgc
gcctacgacaccgccacggtgctggccgagcacaacgggctgccggtccgggtcgacacg
cggttgcgcgaaacgcacctgggtgactggcaggggctgacccacgaagaggtcgacgcc
gcggcaccgggtgcgcggttggcgtggcgcgatgatgcccggtgggctccgcacggcggg
gagagcagggtggacgtggccgcgcgcagcgaaccgctggtcgccgagttggtggccggt
gagccggcctgggggagcgccgacgaggcggaccggccggcggtgctcgtcgcccacggc
ggcctgatcgctgcgctgaccgctgcgctgctgcgtcttccggtcgagaactggccggcg
ctgggcgggatggccaacgccagttggacccagctcagcgggtattccgacgattccggc
ggagctgacgacttcgctgacgtgcgttggcgtctcgatgtctggaacgcttcagcgcag
gtggccggcgatgtcctctga

DBGET integrated database retrieval system