KEGG   Mycobacterium sp. JDM601: JDM601_1532Help
Entry
JDM601_1532       CDS       T01512                                 

Gene name
pks16
Definition
polyketide synthase
Orthology
K01909  
long-chain-fatty-acid--[acyl-carrier-protein] ligase [EC:6.2.1.20]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Fatty acid degradation
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mjd00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1659362..1660945
Genome map
AA seq 527 aa AA seqDB search
MSVLAGALTRAMTASDEDLVVFDQASGSWQRHPWAQVHARAQGVASRILDTGRTGAVGLV
GEPTVELVAAIQGAWLAGRSVSILPGPVRGSDPQQWAQATRNRFSGIGVDTVFTHGGPRQ
LLDEAGTAIAVYDVTAAATEPSTAFTPVTAAPDVPAVLQGTAGSTGTPRTAQLSPAAVLA
NVSGLAEHVGVDPATDVGCSWLPLYHDMGLTFLLSAALTGSALWLAPTAAFAASPFRWLS
WLHDSRATMTAAPNFAYGVIGKYARRVPEVDLGRLRVAINGGEPVDCAGLERFVAELGRY
GLAPGALMPSYGLAEATCAVTAPQPGTGLQYDETIGAASDDAPAVRRHAVLGEPIPGMQV
RISPVAERHEELSQREVGEIEIRGTSMMSGYVDQPALDPAGWFATGDLGYFTDAGLVVCG
RAKEIISIAGRNVFPTEIERVAAEVRGVRDGAVVAVGTAGIRAGLVIAAEFRGRDEAGAR
ADVISRVASQCGVVPADVVFLAPGSLPRTSSGKLRRLEVKRNLEVMK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgctggcaggcgccctgaccagggcgatgaccgcctcggatgaggatctggtg
gtcttcgatcaggccagtggcagctggcagcgtcacccgtgggcgcaggtacacgcccgc
gcccagggggtggcgtcgagaattctcgacaccggccgcaccggtgcggtgggcctggtc
ggggagccgaccgtcgaactggtcgccgcgatccagggcgcctggctggccgggcgcagc
gtgtcgatcctgcccggaccggtccgcggctccgatccgcagcaatgggcccaggcgacc
cgaaaccggttcagcggcatcggtgtcgacaccgtcttcacccacggcggacctcggcag
ctgctggatgaggccgggaccgccatcgccgtgtacgacgtcaccgccgccgccaccgag
ccttcgaccgccttcaccccggtgaccgccgcaccggatgtgccggccgtgctgcagggc
accgcaggctccaccggcaccccccgcaccgcccagctgtcaccggcagcggtgctggcc
aacgtctccggcctggccgagcacgtcggcgtcgacccggcgaccgacgtcggctgcagt
tggctgccgctgtaccacgatatggggctgaccttcctgctcagcgcggcgttgaccggg
tctgcgctgtggctggcgcccaccgcggcgttcgccgcgtcgccgtttcgctggttgagc
tggctgcacgacagccgggccaccatgactgccgcacccaacttcgcttacggcgtgatc
ggcaagtacgcccgtcgggttcccgaagtggacctgggccggctgcgggtcgcgatcaac
gggggcgagccggtcgactgtgccggactggagcgattcgtcgccgaactcggcagatac
ggcctcgcccccggtgctctcatgccgtcttacggcctggccgaggccacctgcgcggtg
accgcaccacagccaggtaccggcctgcagtacgacgaaaccatcggcgcggcaagcgat
gacgcgccagcggtgcgcaggcatgcggtgctcggcgaaccgattcccggaatgcaggtc
cggatcagtccggtagccgaacgtcacgaggagctgtcgcagcgcgaggtcggtgagatc
gagatccgcggaacctcgatgatgtccggctatgtcgaccagccggcgttggacccagcc
ggctggttcgccaccggcgacctcggctacttcaccgacgccggactggtggtctgcggc
cgtgccaaagagatcatctcgatcgccggacgcaacgtgtttcccaccgagatcgagcgc
gtggccgccgaggtgcgcggcgtccgcgatggcgcggtggtggcggtcggcacagccggg
atccgggcgggactggtgatcgctgcggagttccgcggccgcgacgaggccggcgcgcgc
gccgacgtgatctcccgggtggcatcgcagtgcggggtggtgcccgcagatgtggtgttc
ctggcgccgggctcgctgccgcggacatcgtcggggaagctgcggcggctggaagtcaaa
cggaacctggaggtgatgaagtga

DBGET integrated database retrieval system