KEGG   Mycolicibacter sinensis: JDM601_1688Help
Entry
JDM601_1688       CDS       T01512                                 

Gene name
sucB
Definition
(GenBank) pyruvate dehydrogenase (E2 component) SucB
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00020  Citrate cycle (TCA cycle)
mjd00310  Lysine degradation
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
Module
mjd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mjd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JDM601_1688 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    JDM601_1688 (sucB)
Enzymes [BR:mjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     JDM601_1688 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: AEF35688
UniProt: F5Z0X3
Position
complement(1841340..1843103)
Genome map
AA seq 587 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKKEGDTVEADEPLLEVSTDKVDTEIPAPVSGVLTKII
AEEDTTVEVGGELALIGEAGESAAGDGEPAQQAAAAEPAEQAPEPAAESKPEPEPEAAES
GAESKPAAAAPAGDGTPVLMPELGESVTEGTVTRWLKQVGDSVEVDEPLVEVSTDKVDTE
IPSPVAGTLLSITAGEDTTVEVGGELAKIGSASAAAAEPATAPAPKPEPEPEPKPEPEPE
PAPETEPARQARPEPTPAPAPAAPKPAAEAPAAGGSDATPYVTPLVRKLAAENDVDLSQV
TGTGVGGRIRKQDVLAFAERQAGQRQAPAAPAARSATPAPAAPALAHLRGTTAKANRIRQ
ITAKKTRESLQATAQLTQTHEVDMTKIVSLRARAKADFAEREGVNLTYLPFIARAVIDAL
KAHPNVNASYNEEAGEITYYDAEHLGFAVDTEQGLLSPVIHNAGDLSLAGLARAIADIAA
RARSGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDDAGN
ESVGVRSVCYLPLTYDHRLIDGADAGRFVTTIRTRLEEGEFEAELGL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcagttcagatgccggccctcggtgagagcgtcaccgagggaaccgtgacc
cgctggctcaaaaaagagggcgacaccgtcgaggctgatgaaccgctgctggaggtctcc
accgacaaggtcgacaccgagatcccggcgccggtgtccggcgtgctgaccaagatcatc
gccgaggaggacaccacggtcgaggtcggcggcgagctggcactgatcggcgaggccggc
gaaagcgctgcgggcgacggcgagcccgcccagcaggccgccgcggccgagcccgccgag
caggcgcccgagcccgccgccgagtccaagccggaaccggagcccgaggccgccgagtcc
ggggccgagtccaagcccgctgcggccgcgccggccggcgacggcaccccggtgctgatg
cccgaattgggcgaatccgtcaccgagggcaccgtgacacgctggctgaagcaggtcggc
gactcggtggaggtcgacgaaccgctggtggaggtctccaccgacaaggtcgacaccgag
atcccctccccggtggccggtacgctgctgtcgatcaccgccggtgaggacaccaccgtc
gaggtcggcggcgagctggccaagatcggatcggcttccgccgcggcggcagagccggca
accgcccccgccccgaaaccggagcccgagccggaacccaagccggaaccggagcccgaa
cccgcgccggaaacggagcccgcccggcaggcccggcccgagcccacgccggctcccgca
ccggccgccccgaaacccgccgccgaggcgccggccgccggcggctccgacgccacgccg
tacgtcaccccgctggtgcgcaagctcgccgccgagaacgacgtcgacctcagccaggtc
accggcaccggcgtcggcgggcggatccgcaagcaggatgtgctggccttcgctgagcgg
caggccggacaacggcaggcaccggccgcaccggccgcccggtcggcgaccccggcgccc
gccgccccggcgctggctcacctgcggggcaccaccgccaaggccaaccggatccgccag
atcaccgccaagaagacccgcgaatccctgcaggccaccgctcagctgacccagacccat
gaggtcgacatgaccaagatcgtgtcgctgcgggccagggccaaagcggatttcgccgag
cgcgagggcgtcaacctgacctacctgccgttcatcgcccgcgcggtgatcgacgcgctg
aaggcccacccgaacgtcaacgccagctataacgaggaagccggcgagatcacctattac
gacgccgagcacctcggcttcgcggtggacaccgagcaggggctgctgtcgccggtgatc
cacaacgccggggacctgtcgctggcggggctggcccgggccatcgccgacatcgccgcc
cgggcacgctccggcggcctgaagcccgacgagctgtccggcggcaccttcacgatcacc
aacatcggcagccagggcgcgctgttcgacaccccgatcctggtgccgccccaggccgcc
atgctcggcaccggggccatcgtcaagcggccacgggtcatcgtcgacgacgccggcaac
gaatcggtcggtgtgcggtcggtctgctacctgccgctgacgtatgaccaccggctgatc
gacggcgccgacgccggacggttcgtgaccacgatccgcacccgactcgaagagggcgag
ttcgaggccgaactggggctttag

DBGET integrated database retrieval system