KEGG   Mycobacterium sp. JDM601: JDM601_1688Help
Entry
JDM601_1688       CDS       T01512                                 

Gene name
sucB
Definition
pyruvate dehydrogenase (E2 component) SucB
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_1688 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JDM601_1688 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    JDM601_1688 (sucB)
Enzymes [BR:mjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     JDM601_1688 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1841340..1843103)
Genome map
AA seq 587 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKKEGDTVEADEPLLEVSTDKVDTEIPAPVSGVLTKII
AEEDTTVEVGGELALIGEAGESAAGDGEPAQQAAAAEPAEQAPEPAAESKPEPEPEAAES
GAESKPAAAAPAGDGTPVLMPELGESVTEGTVTRWLKQVGDSVEVDEPLVEVSTDKVDTE
IPSPVAGTLLSITAGEDTTVEVGGELAKIGSASAAAAEPATAPAPKPEPEPEPKPEPEPE
PAPETEPARQARPEPTPAPAPAAPKPAAEAPAAGGSDATPYVTPLVRKLAAENDVDLSQV
TGTGVGGRIRKQDVLAFAERQAGQRQAPAAPAARSATPAPAAPALAHLRGTTAKANRIRQ
ITAKKTRESLQATAQLTQTHEVDMTKIVSLRARAKADFAEREGVNLTYLPFIARAVIDAL
KAHPNVNASYNEEAGEITYYDAEHLGFAVDTEQGLLSPVIHNAGDLSLAGLARAIADIAA
RARSGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDDAGN
ESVGVRSVCYLPLTYDHRLIDGADAGRFVTTIRTRLEEGEFEAELGL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcagttcagatgccggccctcggtgagagcgtcaccgagggaaccgtgacc
cgctggctcaaaaaagagggcgacaccgtcgaggctgatgaaccgctgctggaggtctcc
accgacaaggtcgacaccgagatcccggcgccggtgtccggcgtgctgaccaagatcatc
gccgaggaggacaccacggtcgaggtcggcggcgagctggcactgatcggcgaggccggc
gaaagcgctgcgggcgacggcgagcccgcccagcaggccgccgcggccgagcccgccgag
caggcgcccgagcccgccgccgagtccaagccggaaccggagcccgaggccgccgagtcc
ggggccgagtccaagcccgctgcggccgcgccggccggcgacggcaccccggtgctgatg
cccgaattgggcgaatccgtcaccgagggcaccgtgacacgctggctgaagcaggtcggc
gactcggtggaggtcgacgaaccgctggtggaggtctccaccgacaaggtcgacaccgag
atcccctccccggtggccggtacgctgctgtcgatcaccgccggtgaggacaccaccgtc
gaggtcggcggcgagctggccaagatcggatcggcttccgccgcggcggcagagccggca
accgcccccgccccgaaaccggagcccgagccggaacccaagccggaaccggagcccgaa
cccgcgccggaaacggagcccgcccggcaggcccggcccgagcccacgccggctcccgca
ccggccgccccgaaacccgccgccgaggcgccggccgccggcggctccgacgccacgccg
tacgtcaccccgctggtgcgcaagctcgccgccgagaacgacgtcgacctcagccaggtc
accggcaccggcgtcggcgggcggatccgcaagcaggatgtgctggccttcgctgagcgg
caggccggacaacggcaggcaccggccgcaccggccgcccggtcggcgaccccggcgccc
gccgccccggcgctggctcacctgcggggcaccaccgccaaggccaaccggatccgccag
atcaccgccaagaagacccgcgaatccctgcaggccaccgctcagctgacccagacccat
gaggtcgacatgaccaagatcgtgtcgctgcgggccagggccaaagcggatttcgccgag
cgcgagggcgtcaacctgacctacctgccgttcatcgcccgcgcggtgatcgacgcgctg
aaggcccacccgaacgtcaacgccagctataacgaggaagccggcgagatcacctattac
gacgccgagcacctcggcttcgcggtggacaccgagcaggggctgctgtcgccggtgatc
cacaacgccggggacctgtcgctggcggggctggcccgggccatcgccgacatcgccgcc
cgggcacgctccggcggcctgaagcccgacgagctgtccggcggcaccttcacgatcacc
aacatcggcagccagggcgcgctgttcgacaccccgatcctggtgccgccccaggccgcc
atgctcggcaccggggccatcgtcaagcggccacgggtcatcgtcgacgacgccggcaac
gaatcggtcggtgtgcggtcggtctgctacctgccgctgacgtatgaccaccggctgatc
gacggcgccgacgccggacggttcgtgaccacgatccgcacccgactcgaagagggcgag
ttcgaggccgaactggggctttag

DBGET integrated database retrieval system