KEGG   Mycobacterium sp. JDM601: JDM601_1688Help
Entry
JDM601_1688       CDS       T01512                                 

Gene name
sucB
Definition
pyruvate dehydrogenase (E2 component) SucB
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_1688 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JDM601_1688 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    JDM601_1688 (sucB)
Enzymes [BR:mjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     JDM601_1688 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1841340..1843103)
Genome map
AA seq 587 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKKEGDTVEADEPLLEVSTDKVDTEIPAPVSGVLTKII
AEEDTTVEVGGELALIGEAGESAAGDGEPAQQAAAAEPAEQAPEPAAESKPEPEPEAAES
GAESKPAAAAPAGDGTPVLMPELGESVTEGTVTRWLKQVGDSVEVDEPLVEVSTDKVDTE
IPSPVAGTLLSITAGEDTTVEVGGELAKIGSASAAAAEPATAPAPKPEPEPEPKPEPEPE
PAPETEPARQARPEPTPAPAPAAPKPAAEAPAAGGSDATPYVTPLVRKLAAENDVDLSQV
TGTGVGGRIRKQDVLAFAERQAGQRQAPAAPAARSATPAPAAPALAHLRGTTAKANRIRQ
ITAKKTRESLQATAQLTQTHEVDMTKIVSLRARAKADFAEREGVNLTYLPFIARAVIDAL
KAHPNVNASYNEEAGEITYYDAEHLGFAVDTEQGLLSPVIHNAGDLSLAGLARAIADIAA
RARSGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDDAGN
ESVGVRSVCYLPLTYDHRLIDGADAGRFVTTIRTRLEEGEFEAELGL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcagttcagatgccggccctcggtgagagcgtcaccgagggaaccgtgacc
cgctggctcaaaaaagagggcgacaccgtcgaggctgatgaaccgctgctggaggtctcc
accgacaaggtcgacaccgagatcccggcgccggtgtccggcgtgctgaccaagatcatc
gccgaggaggacaccacggtcgaggtcggcggcgagctggcactgatcggcgaggccggc
gaaagcgctgcgggcgacggcgagcccgcccagcaggccgccgcggccgagcccgccgag
caggcgcccgagcccgccgccgagtccaagccggaaccggagcccgaggccgccgagtcc
ggggccgagtccaagcccgctgcggccgcgccggccggcgacggcaccccggtgctgatg
cccgaattgggcgaatccgtcaccgagggcaccgtgacacgctggctgaagcaggtcggc
gactcggtggaggtcgacgaaccgctggtggaggtctccaccgacaaggtcgacaccgag
atcccctccccggtggccggtacgctgctgtcgatcaccgccggtgaggacaccaccgtc
gaggtcggcggcgagctggccaagatcggatcggcttccgccgcggcggcagagccggca
accgcccccgccccgaaaccggagcccgagccggaacccaagccggaaccggagcccgaa
cccgcgccggaaacggagcccgcccggcaggcccggcccgagcccacgccggctcccgca
ccggccgccccgaaacccgccgccgaggcgccggccgccggcggctccgacgccacgccg
tacgtcaccccgctggtgcgcaagctcgccgccgagaacgacgtcgacctcagccaggtc
accggcaccggcgtcggcgggcggatccgcaagcaggatgtgctggccttcgctgagcgg
caggccggacaacggcaggcaccggccgcaccggccgcccggtcggcgaccccggcgccc
gccgccccggcgctggctcacctgcggggcaccaccgccaaggccaaccggatccgccag
atcaccgccaagaagacccgcgaatccctgcaggccaccgctcagctgacccagacccat
gaggtcgacatgaccaagatcgtgtcgctgcgggccagggccaaagcggatttcgccgag
cgcgagggcgtcaacctgacctacctgccgttcatcgcccgcgcggtgatcgacgcgctg
aaggcccacccgaacgtcaacgccagctataacgaggaagccggcgagatcacctattac
gacgccgagcacctcggcttcgcggtggacaccgagcaggggctgctgtcgccggtgatc
cacaacgccggggacctgtcgctggcggggctggcccgggccatcgccgacatcgccgcc
cgggcacgctccggcggcctgaagcccgacgagctgtccggcggcaccttcacgatcacc
aacatcggcagccagggcgcgctgttcgacaccccgatcctggtgccgccccaggccgcc
atgctcggcaccggggccatcgtcaagcggccacgggtcatcgtcgacgacgccggcaac
gaatcggtcggtgtgcggtcggtctgctacctgccgctgacgtatgaccaccggctgatc
gacggcgccgacgccggacggttcgtgaccacgatccgcacccgactcgaagagggcgag
ttcgaggccgaactggggctttag

DBGET integrated database retrieval system