KEGG   Mycobacterium sp. JDM601: JDM601_1771Help
Entry
JDM601_1771       CDS       T01512                                 

Gene name
cysQ
Definition
monophosphatase CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    JDM601_1771 (cysQ)
Enzymes [BR:mjd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     JDM601_1771 (cysQ)
Transfer RNA biogenesis [BR:mjd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    JDM601_1771 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928424..1929206
Genome map
AA seq 260 aa AA seqDB search
MTLTDAALAAELAVEAGKLLLKVRDEVGFGHPWRLGDAGDALANRLILSRLREVRPDDAV
LSEESPDDLARLRADRVWIIDPLDGTREFTTPGRDDWAVHIALWQRDGSGPGAITDAAVS
LPAYDNRSNVVFATDTVTANASPAGVPNPIRVAVSATRMPAVVRIIREVLPVEPVLMGSA
GAKAMAVVRGDVDAYLHAGGQWEWDSAAPAGVVRAAGLHASRLDGSPLLYNRPDPYLPDL
LMCRPEVAPTLLDAMRRTLL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaccgacgcggcgctggccgccgaactggccgtcgaggccgggaagctgttg
ctcaaggtccgcgacgaggtggggttcggccacccgtggcgcctcggcgacgccggggat
gcgctcgccaaccgtttgatcctcagccggctgcgggaggtacgccccgacgacgcggtg
ctcagcgaggaatcgcccgacgatctggcccggttgcgggccgaccgggtctggatcatc
gacccgctcgacggcacccgggagttcaccacccccggacgtgatgactgggcggtgcat
atcgcgctgtggcagcgggacggctcggggccgggcgccatcaccgacgcggcggtgtcg
ctgccggcctatgacaacaggagcaacgtcgtcttcgccaccgacaccgtcaccgcgaac
gcctcgccggccggggtcccgaacccgatacgggtggcggtcagcgcaacccggatgccc
gcggtggtgcgcatcatccgggaggtgcttccggtcgaaccggtgctgatgggttcggcg
ggcgccaaggcgatggcggtggtgcgcggcgacgtggacgcctacctgcacgccggcggc
caatgggagtgggattctgccgctccggccggtgtggtgcgggcggccgggctgcacgcc
tctcggctcgacgggtcgccgctgctctacaaccgccccgacccctacctgcccgacctg
ctgatgtgccggcccgaggtggcgccgacgctactcgacgccatgcggcgcacactgctg
tag

DBGET integrated database retrieval system