KEGG   Mycolicibacter sinensis: JDM601_1778Help
Entry
JDM601_1778       CDS       T01512                                 

Gene name
hisG
Definition
(GenBank) ATP phosphoribosyltransferase HisG
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00340  Histidine metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01230  Biosynthesis of amino acids
Module
mjd_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    JDM601_1778 (hisG)
Enzymes [BR:mjd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     JDM601_1778 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG HisG_C
Motif
Other DBs
NCBI-ProteinID: AEF35778
UniProt: F5Z1V2
Position
1937293..1938153
Genome map
AA seq 286 aa AA seqDB search
MLRVAVPNKGALSESAAAMLAEAGYRSRADAKDLTVLDPSNKVEFFFLRPKDIAIYVGSG
ELDLGVTGRDLALESTAPVRERLALGFGSSRFRYAAPAGRDWTVADLAGKRIATAYPNLV
RKDLAAKGIEATVIRLDGAVEISIQLGVADAIADVVGSGRTLRQHDLVAFGETLCDSEAV
LIEAAKPNGRSEQTAAARDQLAGRVRGVVFGQQYLMLDYNCPRAALEQAAAITPGLESPT
IAPLAEPDWIAVRALVPRRQVNTIMDELAAIGAKAILASDIRFCRF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgtcgcggttcccaacaagggagcgctcagtgagtccgccgcggcgatgctg
gcggaggccggctaccgcagccgcgccgacgccaaggacctgacggtcctggatccgtcg
aacaaggtggagttcttcttcctgcggcccaaggacatcgccatctacgtcgggtcgggg
gagctggacctgggggtcaccggccgggacctggccctggaatccactgcgccggtgcgc
gaacggctggcgttgggattcggctcgtcgcggttccgctacgccgccccggccgggcgg
gactggaccgtggcggatctggccggaaagcggatcgccaccgcttatcccaatctcgtt
cggaaagacctggcggccaagggaatcgaggcgaccgtcatccgtctggacggcgcggtg
gagatctcgatacagctcggggtggccgacgcgatcgccgacgtggtcgggtcgggccgc
accttgcgccagcacgacctggtggctttcggtgagacactgtgcgattcggaggcggtg
ctcatcgaggccgccaagccgaacggccgcagtgaacagacggccgcagcccgcgatcag
ctggcgggccgggtgcgcggcgtggtcttcggtcagcagtacctgatgctggactacaac
tgtccgcgggcggctcttgagcaggctgccgcgatcacccccggcctggagtcaccgacc
atcgctccgctggccgagccggactggatcgctgtccgcgcgctggtgccgcgccgccag
gtcaacacgatcatggacgaactggccgccatcggggccaaggccatcctcgcctcggac
atcaggttctgccgattttga

DBGET integrated database retrieval system