KEGG   Mycobacterium sp. JDM601: JDM601_1778Help
Entry
JDM601_1778       CDS       T01512                                 

Gene name
hisG
Definition
ATP phosphoribosyltransferase
Orthology
K00765  
ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mjd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mjd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1937293..1938153
Genome map
AA seq 286 aa AA seqDB search
MLRVAVPNKGALSESAAAMLAEAGYRSRADAKDLTVLDPSNKVEFFFLRPKDIAIYVGSG
ELDLGVTGRDLALESTAPVRERLALGFGSSRFRYAAPAGRDWTVADLAGKRIATAYPNLV
RKDLAAKGIEATVIRLDGAVEISIQLGVADAIADVVGSGRTLRQHDLVAFGETLCDSEAV
LIEAAKPNGRSEQTAAARDQLAGRVRGVVFGQQYLMLDYNCPRAALEQAAAITPGLESPT
IAPLAEPDWIAVRALVPRRQVNTIMDELAAIGAKAILASDIRFCRF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgtcgcggttcccaacaagggagcgctcagtgagtccgccgcggcgatgctg
gcggaggccggctaccgcagccgcgccgacgccaaggacctgacggtcctggatccgtcg
aacaaggtggagttcttcttcctgcggcccaaggacatcgccatctacgtcgggtcgggg
gagctggacctgggggtcaccggccgggacctggccctggaatccactgcgccggtgcgc
gaacggctggcgttgggattcggctcgtcgcggttccgctacgccgccccggccgggcgg
gactggaccgtggcggatctggccggaaagcggatcgccaccgcttatcccaatctcgtt
cggaaagacctggcggccaagggaatcgaggcgaccgtcatccgtctggacggcgcggtg
gagatctcgatacagctcggggtggccgacgcgatcgccgacgtggtcgggtcgggccgc
accttgcgccagcacgacctggtggctttcggtgagacactgtgcgattcggaggcggtg
ctcatcgaggccgccaagccgaacggccgcagtgaacagacggccgcagcccgcgatcag
ctggcgggccgggtgcgcggcgtggtcttcggtcagcagtacctgatgctggactacaac
tgtccgcgggcggctcttgagcaggctgccgcgatcacccccggcctggagtcaccgacc
atcgctccgctggccgagccggactggatcgctgtccgcgcgctggtgccgcgccgccag
gtcaacacgatcatggacgaactggccgccatcggggccaaggccatcctcgcctcggac
atcaggttctgccgattttga

DBGET integrated database retrieval system