KEGG   Mycolicibacter sinensis: JDM601_1858Help
Entry
JDM601_1858       CDS       T01512                                 

Definition
(GenBank) O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00350  Tyrosine metabolism
mjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    JDM601_1858
Enzymes [BR:mjd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     JDM601_1858
Exosome [BR:mjd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   JDM601_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEF35858
UniProt: F5Z2S1
Position
complement(2025488..2026309)
Genome map
AA seq 273 aa AA seqDB search
MTDAHTCYMNSPPRRAERHKIAAMSLKRRLPFLRWSFLRMATGGRNITTTGQIGDGREAA
AVDYVLAHARAGDIDDVLARIDEFAYEKSLLINIGDEKGALLDAAVQRVQPALALELGTY
CGYSALRIARSAPAARIYSIELAEANADNARQIWAHAGVADRITCVVGTIGDGGRTLDVL
TARHGFAAGTLDFLFLDHDKDAYLSDLQSILDRGWLHPGSVVVADNVKVPGAPRYREYMR
AQQGTHWDTVEHKTHVEYQRLLSDLVLESTYLG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcccacacctgctacatgaacagtccgccgcggcgtgccgagcgccataag
atcgcagccatgagcctgaaacgacgcctccccttcctgcggtggtcgttcctgcggatg
gcgaccggcggccgcaacatcaccaccaccggccagatcggcgacggccgcgaagccgcc
gccgtcgactacgtgctggcccatgcccgagccggcgatatcgacgacgtgctggcccgc
atcgacgagttcgcctacgagaagtcgctgctgatcaatatcggcgacgagaagggcgcc
ctgctcgacgccgcggtgcaacgggtccagccggccctggccctggagctgggcacctac
tgcggctacagcgccctgcgtatcgcccgctccgcaccggcggcccggatctattcgatt
gagctggccgaggccaacgccgacaacgcccggcagatctgggcgcacgccggggtggcc
gaccggatcacctgcgtggtgggcaccatcggtgacggcgggcgcaccctggacgtactg
accgcgcggcacggcttcgccgccggcacgctggatttcctgttcctcgaccacgacaag
gacgcctacctgtcggatctccagagcattttggaccggggctggctgcatccggggtcg
gtcgtggtcgccgacaatgtcaaggtgccgggagcgccgcgctaccgcgaatacatgcgg
gctcaacaggggacgcactgggacaccgtcgaacacaagacccacgtggagtatcagcgt
ctgttgtccgacctggtgctcgagtcgacgtacctggggtaa

DBGET integrated database retrieval system