KEGG   Mycobacterium sp. JDM601: JDM601_1858Help
Entry
JDM601_1858       CDS       T01512                                 

Definition
O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mjd00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2025488..2026309)
Genome map
AA seq 273 aa AA seqDB search
MTDAHTCYMNSPPRRAERHKIAAMSLKRRLPFLRWSFLRMATGGRNITTTGQIGDGREAA
AVDYVLAHARAGDIDDVLARIDEFAYEKSLLINIGDEKGALLDAAVQRVQPALALELGTY
CGYSALRIARSAPAARIYSIELAEANADNARQIWAHAGVADRITCVVGTIGDGGRTLDVL
TARHGFAAGTLDFLFLDHDKDAYLSDLQSILDRGWLHPGSVVVADNVKVPGAPRYREYMR
AQQGTHWDTVEHKTHVEYQRLLSDLVLESTYLG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcccacacctgctacatgaacagtccgccgcggcgtgccgagcgccataag
atcgcagccatgagcctgaaacgacgcctccccttcctgcggtggtcgttcctgcggatg
gcgaccggcggccgcaacatcaccaccaccggccagatcggcgacggccgcgaagccgcc
gccgtcgactacgtgctggcccatgcccgagccggcgatatcgacgacgtgctggcccgc
atcgacgagttcgcctacgagaagtcgctgctgatcaatatcggcgacgagaagggcgcc
ctgctcgacgccgcggtgcaacgggtccagccggccctggccctggagctgggcacctac
tgcggctacagcgccctgcgtatcgcccgctccgcaccggcggcccggatctattcgatt
gagctggccgaggccaacgccgacaacgcccggcagatctgggcgcacgccggggtggcc
gaccggatcacctgcgtggtgggcaccatcggtgacggcgggcgcaccctggacgtactg
accgcgcggcacggcttcgccgccggcacgctggatttcctgttcctcgaccacgacaag
gacgcctacctgtcggatctccagagcattttggaccggggctggctgcatccggggtcg
gtcgtggtcgccgacaatgtcaaggtgccgggagcgccgcgctaccgcgaatacatgcgg
gctcaacaggggacgcactgggacaccgtcgaacacaagacccacgtggagtatcagcgt
ctgttgtccgacctggtgctcgagtcgacgtacctggggtaa

DBGET integrated database retrieval system