KEGG   Mycobacterium sp. JDM601: JDM601_1929Help
Entry
JDM601_1929       CDS       T01512                                 

Gene name
glcB
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_1929 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    JDM601_1929 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    JDM601_1929 (glcB)
Enzymes [BR:mjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     JDM601_1929 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2103310..2105556)
Genome map
AA seq 748 aa AA seqDB search
MREETMTDRVPVGGLRVARVLYDFITEEALPGTGLDPDSFWAGVDKVVTDLTPKNQELLA
RRDELQAQIDKWHRHRVIEPVDTEAYRAFLTEIGYLLPEPDDFTVTTADVDDEIAVQAGP
QLVVPVLNARFALNAANARWGSLYDALYGTDVISEDDGATKTPAGANSGYNPVRGDKVIA
YARKFLDESVPLANGAWAEVKSFAVDDARLVITLADGLETTVAAPAEFVGYLGDAEAPSS
VLLIHHGLHIEILIDPNSPIGATDAAGIKDVVLESAVTTIMDFEDSVAAVDAEDKVLGYR
NWLGLNRGDLAEEVSKDGKTFTRTLSGDREFSAPDGGTLTLPGRSLMFVRNVGHLMTNDA
IVFGAEGTDGAEGTDSREVFEGIQDALFTGLIAVHGLTASDDNGPLLNSRTGSIYIVKPK
MHGPDEVAFTAELFSRVEDVLGLPQATLKIGIMDEERRTTVNLRACIKAAVDRVVFINTG
FLDRTGDEIHTSMEAGPMVRKATMKSQPWILAYEDNNVDAGLATGLTGHAQIGKGMWAMT
DLMADMVEQKIGHPRAGASTAWVPSPTAATLHAMHYHQVDVFEVQRELAGKRRATIDQLL
TIPLSEGLAWAPDEIREEVDNNCQSILGYVVRWISQGVGCSKVPDIHDVALMEDRATLRI
SSQLLANWLRHGVITADDVQSSLERMAPAVDRQNAGDPTYLPMAPDFDDSIAFAAARELI
LSGTTQPNGYTEPILHRRRREFKARAGR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgagggaggaaaccatgacggatcgggtgccggttggcggtctgcgggtggcgcgtgtg
ctctacgacttcatcaccgaggaggcgctgccggggaccggtctggacccggacagcttc
tgggcgggcgtggacaaggtcgtcaccgatctgacgccgaagaaccaggagctgctggcg
cgtcgtgacgagctgcaggcacagatcgacaagtggcaccggcaccgggtcatcgagccg
gtggacaccgaggcctaccgggccttcctcaccgagatcggctacctgctgcccgagccg
gacgacttcaccgtcaccaccgccgacgtcgacgacgagatcgccgtgcaggccggcccg
cagctggtggtgccggtgctcaacgcccggttcgcgctcaacgccgccaacgcccgctgg
ggctcgttgtatgacgcgctgtacggcaccgacgtgatcagtgaggacgacggcgcaacg
aagacacccgcgggagcgaacagcggctacaacccggtgcgcggcgacaaggtgatcgcc
tatgcccgcaagttcctcgacgagtccgtgccgctggccaacggcgcctgggccgaggtc
aagagcttcgcggtggacgacgcccggctggtgatcacactggccgacggtctggagacc
accgtggccgcgccggcggagttcgtcggctacctcggggacgccgaggcaccgtcatcg
gtgctgttgatccaccacgggctgcacatcgagatcctgatcgacccgaactcgccgatc
ggagcgaccgatgccgccggcatcaaggacgtggtgctcgagtcggcggtcaccacgatc
atggacttcgaggactcggttgccgcggtcgacgccgaggacaaggtgctcggctaccgc
aactggctggggctcaatcgcggggatctggccgaagaggtcagcaaggacggcaagacg
ttcacccggacactgtccggcgaccgcgagttcagcgctcccgacggcggaacccttacc
ctgccgggccgcagcctgatgttcgtccgcaacgtgggtcatctgatgaccaacgacgcc
atcgtcttcggcgccgaggggacggacggcgccgagggcactgacagccgcgaggtgttc
gagggcatccaggacgcgctgttcaccgggctgatcgccgtgcacgggttgactgcctcc
gacgacaacggcccgctgctcaacagccgcacggggtcgatctacatcgtcaaaccgaag
atgcacggacccgacgaggtggcgttcaccgccgaattgttcagccgggtcgaagacgtc
ctcggcctgccgcaggcgaccctcaagatcggcatcatggacgaggagcgccgcaccacc
gtcaacctgcgggcctgtatcaaggcggccgtcgaccgggtggtgttcatcaacaccggc
ttcctggaccgcaccggcgacgagatccacacctcgatggaggccgggccgatggtgcgc
aaggccaccatgaagtcgcagccgtggatcctggcctacgaggacaacaacgtcgacgcg
ggcctggccaccggattgaccggccacgcccagatcggcaagggcatgtgggcgatgacc
gacctgatggccgacatggtcgagcagaagatcgggcacccgcgcgccggcgccagcacc
gcctgggtgccgtcgccgaccgccgccaccctgcacgcgatgcactaccaccaggtggac
gtgttcgaggtgcagcgggagttggctggaaaacgccgcgccacaatcgatcagctgctg
accatcccgctctccgaggggctggcctgggcccccgacgagatccgcgaggaggtcgac
aacaactgccagtcgatcctcggctacgtcgttcgctggatctcgcagggcgtgggctgc
tcgaaggttcccgacatccacgatgtggcactgatggaagaccgtgcgacactgcggatc
tcatcgcagctgctggcgaactggctgcggcacggggtgatcaccgctgacgacgtgcag
tccagcctggagcggatggccccggccgtggaccggcagaacgcaggcgatccgacttac
ctgccgatggctccggatttcgacgacagcatcgcgtttgcggccgcccgtgagctgatc
ctgtccggaacgactcagcccaacggctacaccgagccgatcctgcaccggcgccgacgc
gagttcaaagcccgcgccggccgctga

DBGET integrated database retrieval system