KEGG   Mycobacterium sp. JDM601: JDM601_1950Help
Entry
JDM601_1950       CDS       T01512                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    JDM601_1950 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_1950 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    JDM601_1950 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    JDM601_1950 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    JDM601_1950 (adhA)
   00626 Naphthalene degradation
    JDM601_1950 (adhA)
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     JDM601_1950 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2124269..2125276
Genome map
AA seq 335 aa AA seqDB search
MTMTAWRVDRPGPIAGGPLHRVSTAVPRPQPSELLVAVRACGVCRTDLHVTEGDLPVHRA
GVTPGHEVVGEVVEVGAEAGGGFAVGDRVGIAWLRHTCGSCRYCRRGDENLCPRSRYTGW
DDDGGYAEFATVPAAFAHHLPGGYSDSELAPLLCAGIIGYRSLQLADLPPGGRLGIYGFG
GSAHITAQVALARGAEVHVMTRDPQARELALQLGAASVQGAADPPPVRLDSAILFAPVGE
LVPPACQALDRGGTCAIAGIHLSDIPSLNYQRDLFYERRIRSVTSNTRADAREFLEFAAA
HHITVTTPEYSLGDADRALADLAADRIAGAAVLVV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgaccgcctggcgggtggatcgtcccggtcccatcgccggcggtccattgcac
cgggtcagcacagcggtgccccggccgcagccctcggagttgctggtcgcggtgcgcgct
tgcggggtgtgccgcaccgacctgcacgtcaccgaaggtgacctaccggtgcaccgcgcc
ggggtcacccccggccacgaggtggtcggcgaggtcgtcgaggtgggcgctgaggccggc
gggggcttcgccgtgggggatcgggtcggaatcgcctggcttcggcacacctgcggaagc
tgccgctactgtcgccggggcgatgagaacctgtgtccgcggtcgcgctacaccggctgg
gacgacgacggcgggtatgccgaattcgcgactgtcccagccgcgttcgcccatcacctg
cccggcggctacagcgacagcgagttagcgccgctgctgtgcgccggcatcatcggctac
cgctcgttgcaactggccgacctgccgcccggcggccggctgggaatctacgggttcggc
ggcagtgcgcacatcaccgcgcaggtcgcgttggcccgcggcgccgaggtgcacgtcatg
acccgcgatccgcaggcgcgggagctggcgctgcagctgggggcggcctcggtccagggg
gcggccgacccgccgccggtgcggttggactcggccatcctgttcgcgccggtcggcgag
ctggtgccgcccgcctgccaggccctggatcgcggtggcacgtgcgcgatcgctggaatc
catctgagcgatatcccgtcgctgaactaccagcgcgacctgttctacgaacgccggatc
cggtcggtgacgtcgaacacccgcgctgacgcccgcgagttcctcgagttcgccgcggcg
caccacatcactgtgacgacgccggagtactcgctgggcgacgccgaccgggcactggcg
gaccttgccgcggaccggatcgccggtgcggccgtgctggtggtgtga

DBGET integrated database retrieval system