KEGG   Mycolicibacter sinensis: JDM601_2004Help
Entry
JDM601_2004       CDS       T01512                                 

Gene name
aceAb
Definition
(GenBank) isocitrate lyase AceAb
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00630  Glyoxylate and dicarboxylate metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01200  Carbon metabolism
Module
mjd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JDM601_2004 (aceAb)
Enzymes [BR:mjd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     JDM601_2004 (aceAb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEF36004
UniProt: F5YS44
Position
complement(2177069..2179366)
Genome map
AA seq 765 aa AA seqDB search
MTTIETNAATSAPVQRDIEADVAATQHYFDSPRFEGITRLYSARQVVEQRGTIPSDYIVA
REAATAFYARLRELFAAKKSITTFGPYSPGQAVVMKRVGIEGIYLGGWATSAKGSITEDP
GPDLASYPLSQVPDEAAGLVRALLTADRNQHYLRLQMTEEQRAATPAVDYRPFIIADADT
GHGGDPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQL
DLMGVPGIIVARTDAEAANLVESRADERDQPFILGTTNLKIPSYKACFLAMTRQFYNAGI
TEINGHLLYALPEGEYTAADTWLERNGITALITAAAESRRGNGQSVDGIYDEIESKFVEA
WQNDAGLMTFGDAVAEMLEFAEREGEPKDMSAAEWREFAARAPLYTARQKATELHADPGW
DCERAKTPEGYFQVRGGIPYAIAKSLAAAPFADLLWMETKTADLDDAREFAEAIHAVYPD
QMLAYNLSPSFNWDTTGMTDEQMRAFPAELGKMGFVFNFITYGGHQVDGVASEEFAATLL
QDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGAGSTQHQHL
VQTEVPKKLLEEWLALWAEHYQLGERLRVHLRPTRPGSDVLELGIYGDDDEKLANVIVDP
IKDRHGRSILTVRDQNTFAEKFRQKRLMDLTHLWLIHRFKAAAVHYVTPTQDNLYQTEKM
KAHGMFSSVHQEVGEIIVADVNQPRIDELLAPDRAALGKLISKED
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatcgagacgaacgcggcgacgagcgcaccggtccaacgagacatcgaagcc
gacgtcgcggcgacacagcactacttcgacagcccgcgcttcgaaggcatcacccgcctc
tacagcgcccgccaggtggtcgagcagcgcggcaccatcccttcggactacatcgtggcg
cgcgaagcagcgacggcgttctacgcccggctgcgtgagctgttcgccgccaagaagagc
atcaccacgttcggcccgtattcgccgggtcaggcggtggtgatgaagcgggtgggcatc
gagggcatctacctgggcgggtgggccacctcagccaaggggtccatcaccgaggatccg
gggcccgacctggccagctacccgctcagccaggtgcccgatgaggcggccgggctggtg
cgtgccctgctcaccgccgaccgcaaccagcactacctgcgcctgcagatgaccgaggag
caacgcgccgccacccccgccgtggactaccggccgttcatcatcgccgacgcggacacc
ggtcacggcggtgatcctcacgtacgcaacctgatccggcgtttcgtggaggccggcgtg
cccggctaccacatcgaggatcagcgtcccggcaccaagaagtgcggccaccaggggggc
aaggtgttggtgccctccgacgagcagatcaagcggctgaataccgcccgcttccagttg
gacctgatgggcgtccccggcatcatcgtcgcgcgcaccgacgccgaggcggccaacctg
gtcgagagccgcgctgacgaacgcgaccagccgttcatcctgggcaccaccaacttgaag
atcccgtcctacaaggcctgtttcctggcgatgacgcgccagttctacaacgccgggatc
accgagatcaacggccatctgctctacgccctccccgagggcgagtacaccgccgccgac
acctggctggagcgcaacggcatcaccgcgctgatcacggcggcggccgagagtcggcgc
ggcaatgggcaatccgtggacggcatctacgacgagatcgaatcgaagttcgtcgaggcg
tggcagaacgacgccgggctgatgacgttcggggacgccgtcgccgagatgctcgagttc
gccgaacgtgaaggcgaaccgaaagacatgagcgccgcggaatggcgggaattcgccgcc
cgggcaccgctttacaccgcgcgacagaaggcaaccgaactccatgccgacccgggctgg
gactgcgaacgggccaagactcccgaaggctacttccaggtgcgcggcggcattccctac
gcgatcgccaagtcgctggccgccgcccccttcgccgacttgttgtggatggagaccaag
accgccgatctcgacgacgcccgcgagttcgccgaggcgatccacgccgtgtatcccgac
cagatgctcgcctacaacctgtccccctcgttcaactgggacaccaccggcatgaccgac
gagcagatgcgggccttcccagctgaactcggcaaaatggggttcgtcttcaacttcatc
acctacggcggccaccaggtcgacggggtggcctccgaggagttcgcggcgaccctgctg
caggacggcatgttggcgctggcccggctgcagcgcaagatgcggctggtcgagtcgccc
taccggaccccgcagaccctggtcgggggaccgcgtagcgacgccgcactggccgcctcg
tcgggccgcaccgccaccaccaaggcgatgggcgcaggctccacccagcatcagcacctg
gtgcagaccgaggttcccaagaagctgctcgaggaatggctggcgttgtgggccgagcac
tatcagctcggggagcgactgcgcgtgcacctgcggccgacccggcccggctccgatgtg
ctggaactggggatctacggtgacgacgacgagaagctcgccaacgtgatcgtcgacccg
atcaaggaccggcatgggcgcagcatcctgacagtgcgcgaccagaacaccttcgccgag
aagtttcggcagaagcggctgatggacctgacccacctgtggctgatccaccgcttcaag
gctgcggcggtgcactatgtcacgcccacccaggacaacctgtatcagaccgagaagatg
aaggcacacggcatgttcagcagcgtccaccaggaggtcggcgagatcatcgtcgccgac
gtgaaccagccgcgcatcgacgaactgctggcaccggaccgggcggcgctgggcaagctg
atcagcaaggaggactag

DBGET integrated database retrieval system