KEGG   Mycobacterium sp. JDM601: JDM601_2019Help
Entry
JDM601_2019       CDS       T01512                                 

Definition
flavoprotein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    JDM601_2019
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     JDM601_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2196514..2198109)
Genome map
AA seq 531 aa AA seqDB search
MTTTSVTTDVVIVGFGAAGTSAAITAREHGAEVIAVDRANGGGATAISGGIIYAGGGTSV
QQAAGVDDSAEQMLDYLRLEVGDAVSPETLQRFVDTSPEMIDWLQRHGVPFNPGLCPYKT
SFPNNRYYLYHSGSENAGVSRAVTPPVQRGHRAYGKGTSGKQIYAPLAESARRLGVDFRP
HTTVTELTQDPSGRVTGVRAMTMGQAPRRIQRRYARLAAISSKPGVYYPPLRAAMDRRLK
KLEQRYARPIEITARRGVVICAGGFIANTEWRKRYAPEFNGGLPLGTSGDDGSGIALAAS
VGGVPDRMDNVSAWRFITPPSAFISSIVVDEKGSRVIDETRYGAALGQALVKNHGSKGWI
LADATLMAEARRQLLTQTLWFQRAQAAALILTGAARGKTLADAARAAGIDPEGLRATVAA
HNDAIDSATEDPAGKPTEFRRRIDRAPFTLLDISVRPNVLLPTPMLTLGGVRVAEDTGAV
IDADGTPIPGLYSAGRTAIGVASRSYVSGLSIADCVFAGRRAGASAAGATV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaccagtgtgacgaccgacgtcgtcatcgtcggattcggcgcggccggcacc
tccgccgcgatcaccgcccgcgaacacggcgccgaggtcatcgcggtggaccgggccaac
ggcggtggcgccaccgccatctccgggggcatcatctacgccggaggcgggacgtcggtc
caacaggccgccggcgtcgacgacagcgccgagcagatgctggactacctgcgcctggaa
gtcggcgacgcggtcagcccggaaacgctacagcgcttcgtcgacaccagcccggagatg
atcgactggttgcagcgccacggggtcccgttcaatccgggcctgtgcccctacaagacg
tcgttcccgaacaatcgctactacctgtatcactccggcagcgagaacgcgggcgtctcc
cgtgcggtgaccccgccggtgcagcgcggccaccgcgcgtacggcaaaggcacctccggg
aagcagatctatgcgccgctggccgaatccgcccgccggctcggcgtggacttccgcccg
cacaccaccgtcaccgagctgacgcaggacccgtcgggacgggtgaccggcgtgcgggcc
atgacgatgggccaggcgccccggcgcatccagcgccgctatgccaggctggccgccatc
tcctcgaaacccggtgtctactacccgccgctgcgtgccgcgatggaccgtcgcctcaag
aaattggagcagcgctatgcccggcccatcgagatcaccgcacggcgcggggtggtcatc
tgcgccggcggtttcatcgccaacaccgaatggcgtaagcgctacgccccggaattcaac
ggcggacttccgttgggcaccagcggcgacgacggcagcggcatcgcgctggcggccagc
gtcggcggcgtgccggaccggatggacaatgtctcggcgtggcggttcatcaccccgccc
agcgcgttcatctcctcgatcgtcgtcgacgagaagggcagtcgggtgatcgacgagacc
cgctacggcgcggcgctggggcaggccttggtgaaaaaccatggcagcaaaggctggatt
ctggccgacgccaccctcatggccgaggcccggcgccaactgctcacccagacgctgtgg
ttccagcgcgcccaggccgcggcgttgatcttgaccggcgcggcgcgcggcaagacgctg
gcggacgccgcccgagccgccgggatcgaccccgagggcctgcgggccaccgtcgccgcg
cacaacgacgcgatcgactccgcgacggaggatccggccggaaagccgaccgaatttcgc
cgccgcatcgaccgcgcccctttcaccctgctggacatctcggtgcggccaaacgtcttg
ctgcccaccccgatgctgacgctgggcggggtgcgcgtcgccgaggacaccggcgcggtc
atcgacgccgacggcacgccgatacccgggctctacagcgccggtcgcaccgcgatcggt
gtcgcctcacgctcctatgtcagcggactgtcgatcgccgactgcgtattcgccggccgt
cgcgccggagccagcgcggccggcgccaccgtctaa

DBGET integrated database retrieval system