KEGG   Mycobacterium sp. JDM601: JDM601_2094Help
Entry
JDM601_2094       CDS       T01512                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mjd00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2269221..2269802)
Genome map
AA seq 193 aa AA seqDB search
MVIMRALIIVDVQNDFCDGGALPVTGAVAVAHGITRYLDSETARDRYHYVVATKDWHIDP
GGHFSQRPDYVTSWPPHCRAGTPGADLHPALRTDRIDAVFTKGDYDAGYSGFGGVDDAGT
ALGDWLHQRNVDRVDVVGVATDYCVRRTAEDAVRAGFATAVLPQLTAGVAADSAAAALTA
MRSAGIAVGEEAR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcatgcgggcgctgatcatcgtcgacgtgcagaacgacttctgtgacggcggc
gcgctgccggtgaccggcgctgtcgcggtcgcccacggcatcacccgttacctcgacagc
gagaccgcacgcgaccgctaccactacgtcgtggcgaccaaagactggcacattgacccc
ggtgggcacttctcgcagcggccggactacgtgacgtcgtggccgccgcattgccgcgcc
ggaacacccggtgcggatcttcatcccgcgctgcgcaccgaccggatcgacgccgtcttc
accaaaggtgactacgacgccggctacagcggattcggcggcgtcgacgacgccggcacc
gccctgggcgactggctgcaccagcgcaacgtggaccgtgtcgatgtggtcggcgtcgcg
accgactactgtgtgcgccgcaccgccgaggacgcggtccgcgccgggttcgccaccgcg
gtgctgccgcaactgaccgcgggggtggccgccgactcggcggccgctgcgctgacggca
atgcgcagcgccggtatcgctgtgggggaggaagcccgatga

DBGET integrated database retrieval system