KEGG   Mycobacterium sp. JDM601: JDM601_2132Help
Entry
JDM601_2132       CDS       T01512                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit TrpB
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    JDM601_2132 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JDM601_2132 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JDM601_2132 (trpB)
Enzymes [BR:mjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     JDM601_2132 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2302954..2304273)
Genome map
AA seq 439 aa AA seqDB search
MSDTAHPNLPRASAGVAEPSRHDPDARGHFGAYGGRYVAEALMAVIEEVTAAYDKVRNDR
EFLDTLDNLQTHYTGRPSPLYEAQRLTAHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RRMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTRRQALNVARMRLLGAEVVS
VESGSQTLKDAINDAFRDWVTNADRTYYCFGTAAGPHPFPTMVRDFQRIVGLEARTQIQQ
LAGRLPDAVVACVGGGSNAIGIFHAFIDDPAVRLIGYEAGGDGVATGRHAATFAGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLRETGRAEYQPITDAEAMEAFGI
LCRTEGIIPAIESAHAVAGALKLAAELGPGKVIVVNLSGRGDKDVETAGKWFGLLGDDDN
AARSDADERRVIQNEGGPA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataccgcgcacccgaaccttccgcgcgccagcgccggagtcgccgaacccagc
cggcacgaccccgatgcccgcgggcacttcggcgcctacggcggccgctacgtcgccgag
gcgttgatggcggtcatcgaagaggtcaccgccgcctacgacaaggtgcgcaacgaccgg
gagttcctcgacaccctcgacaacctgcagacgcactacaccggccggccctcgccgctg
tacgaggcgcagcgcctgaccgcccacgccggcggcgcccgcatcttcctgaagcgcgag
gacctgaaccacaccggctcgcacaagatcaacaacgtgctgggccaggccctgttggcg
cggcggatgggcaagacccgggtgatcgccgagaccggcgccggccagcacggggtggcc
accgccaccgcctgcgccctgctgggcctggagtgcgtgatctacatgggagccgtcgac
acccgccgccaggcgctcaacgtggcccggatgcggctgctgggcgccgaggtggtctcg
gtggaatcgggctcgcagacgctcaaggacgccatcaacgacgcgttccgggactgggtg
accaacgccgatcgaacctactactgcttcgggaccgcggccgggccgcacccgttcccg
accatggtgcgcgacttccagcggatcgtcgggctggaggcccgcacgcagatccagcaa
ctggccggccggctgcccgatgccgtggtggcctgcgtcggcggcgggtcgaacgccatc
ggcatcttccatgcgttcatcgacgaccccgcggtgcggctgatcggctacgaagccggc
ggcgacggcgtggccaccggtcggcacgccgcgacgttcgccggtggctccccgggggcg
tttcagggctcgttctcctacctgctgcaggacgaggacgggcagaccatcgagtcacac
tcgatctcggcgggtctggactatcccggcgtcggcccggagcacgcctggctgcgcgag
acggggcgcgccgagtatcagccgatcaccgacgccgaggcgatggaggcgttcggaata
ctctgccgcaccgagggaatcatcccggcgatcgaatcagcgcacgcggtggccggcgcg
ctcaagctggccgccgagctgggcccgggcaaggtcatcgtggtcaacctgtccggacgc
ggcgacaaggacgtcgaaaccgcgggcaagtggttcggactgctgggcgacgatgacaat
gcagcgcgaagcgatgccgacgaacggcgcgtgatccagaacgagggtgggccggcatga

DBGET integrated database retrieval system