KEGG   Mycolicibacter sinensis: JDM601_2147Help
Entry
JDM601_2147       CDS       T01512                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00340  Histidine metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01230  Biosynthesis of amino acids
Module
mjd_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    JDM601_2147 (hisD)
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     JDM601_2147 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEF36147
UniProt: F5YTF2
Position
complement(2316449..2317798)
Genome map
AA seq 449 aa AA seqDB search
MVGVTTPLMSRIDLRGANLSAASLRAALPRGGVDVEAVLPQVRPIVEAVAERGSAAALEF
GESFDGIRPAAVRVPEAALEAALAELDPAVRAALEVAISRARAVHADQRRTDTTTMLAPG
ATVSERWIPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGVDSLVIASPPQADLQGQFQGL
PHPTILAAARLLGVAEVWAVGGAQAVALLAYGGTDTDQAELVPVDMITGPGNIYVTAAKR
LCRSQVGIDAEAGPTEIAILADHTANPAHLAADLISQAEHDELAASVLVTTSPQQADATD
REVTAQLETTVHRQRVVTALTGRQSAIVLVDDLDAGIRVVNAYAAEHLEIQTADAAAVAA
RIRSAGAIFVGPYAPVSLGDYCAGSNHVLPTAGSARHSSGLSVQTFLRGVHVVDYTEAAL
KDVSGHVIALADAEDLPSHGEAVRRRFEQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcgtgaccacaccgctgatgtcgcgcatcgatttgcgtggcgcgaacctgtcg
gcagcttcgctgcgggccgccctgccgcgcggcggtgtcgacgtcgaggcggtgttgcca
caggtgcgcccgatcgtcgaggcggtcgcggaacgcggctcggccgcggcgctggagttc
ggcgaatcgttcgacgggatacgcccggccgcggtccgggtgcccgaagcggcgctggag
gccgcgctggccgagttggacccggcggtgcgcgccgccctggaggtggcgatcagccgc
gcccgcgcggtacacgccgaccagcgacgcaccgacaccaccaccatgctggccccgggc
gcgaccgtcagcgaacgctggattccggtcgagcgcgtcgggttgtacgtgccgggcggc
aacgccgtctacccgtccagcgtggtgatgaacgtggtaccggcccagaccgcgggagtg
gactcgctggtgatcgccagcccgccgcaagcggacctgcagggccagtttcaaggcctg
ccgcacccgacgatcctggccgcggcccgcctgctcggcgtggccgaggtctgggcggtc
ggtggcgcccaggcggtggcgctgctggcctatggcggcaccgacaccgatcaggcagag
ctggttccggtcgacatgatcaccgggcccggcaacatctacgtgaccgccgccaaacgg
ctgtgccgttcccaggtcggcatcgacgccgaagccggacccaccgagatcgcgatcctg
gccgaccacaccgccaacccggcgcatctggccgcggacctcatcagccaggccgagcac
gacgagctggccgccagcgtgctggtcaccaccagtccgcaacaggccgacgcgaccgac
cgcgaagtgaccgcgcaactcgagaccaccgtgcaccgccagcgggtcgtcaccgcactg
acgggacgccaatcggcgatcgtgctggtcgacgacctggacgccggtatccgggttgtc
aatgcctacgccgccgagcacctggagatccagaccgccgacgccgccgcggtggccgcc
cggatccgttcggccggagctattttcgtcggcccgtacgccccggtcagcctcggtgac
tactgcgcgggctccaaccacgtgctgccgacggcgggtagtgcacggcactccagcggg
ttgtcggtgcagaccttcctgcgcggtgtccacgtggtggactacaccgaggccgcgctc
aaagatgtcagcgggcacgtgatcgcgctggccgacgccgaggatctgccctcgcacggc
gaagcggtccggcggaggttcgagcagtga

DBGET integrated database retrieval system