KEGG   Mycobacterium sp. JDM601: JDM601_2274Help
Entry
JDM601_2274       CDS       T01512                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase Tpi
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM601_2274 (tpiA)
   01230 Biosynthesis of amino acids
    JDM601_2274 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_2274 (tpiA)
   00051 Fructose and mannose metabolism
    JDM601_2274 (tpiA)
   00562 Inositol phosphate metabolism
    JDM601_2274 (tpiA)
Enzymes [BR:mjd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     JDM601_2274 (tpiA)
Exosome [BR:mjd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   JDM601_2274 (tpiA)
  Exosomal proteins of bladder cancer cells
   JDM601_2274 (tpiA)
  Exosomal proteins of melanoma cells
   JDM601_2274 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2474059..2474844)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKVAFSLPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLTFGAQDLSQHDAGAYTGEISGAFLAKLGCSYVVVGHSERRSYHGEDDALVAAKAAA
ALKHGLTPIICVGEHLEIREAGNHVEYCVDQLRGSLSGLSAEQIGASVIAYEPVWAIGTG
RVAGAADAQEVCAAIRAELGKLASPKIAEAVRVLYGGSVNAKNIGELIAQPDVDGGLVGG
ASLDGEQFATLAALAAGGPLV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaaaccgctgatcgccggcaactggaagatgaatctcaaccacttcgaggcg
atcgcactggtgcagaaggtggcgttctcgctgccggacaagtattacgacaaggtcgac
gtcacggtgctgccgccgttcaccgacctgcgtagtgtgcagacgctggtcgacggggac
aagcttcggctgaccttcggcgcccaggacctctcgcagcacgacgcgggcgcctacacc
ggcgagatcagcggggcgttcctggccaagctgggctgcagctacgtcgtcgtcggccac
tccgaacggcgcagctaccacggcgaggacgacgcgctggtggccgccaaggccgccgct
gcgctcaagcacgggctcaccccgatcatctgcgtcggcgaacacctcgagatccgggaa
gccggcaaccacgtcgagtactgcgtggaccagctgcgcggctcgctgtccgggctgagc
gccgaacagatcggtgcgagcgtcatcgcctacgaaccggtgtgggcgatcggcaccggc
cgggtcgccggtgccgccgacgcccaggaggtgtgcgcggcgatccgcgccgaactgggc
aagctcgcctccccgaagatcgccgaggcggtacgggtgctctacggcggctcggtcaac
gccaagaacatcggcgaactcatcgcccagcccgacgtcgacggcggtctggtcggcggg
gcgtcgttggacggcgagcagttcgccaccttggcggcgctggcggccggcgggcccctt
gtctag

DBGET integrated database retrieval system