KEGG   Mycolicibacter sinensis: JDM601_2274Help
Entry
JDM601_2274       CDS       T01512                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase Tpi
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00010  Glycolysis / Gluconeogenesis
mjd00051  Fructose and mannose metabolism
mjd00562  Inositol phosphate metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
mjd01230  Biosynthesis of amino acids
Module
mjd_M00002  Glycolysis, core module involving three-carbon compounds
mjd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_2274 (tpiA)
   00051 Fructose and mannose metabolism
    JDM601_2274 (tpiA)
   00562 Inositol phosphate metabolism
    JDM601_2274 (tpiA)
Enzymes [BR:mjd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     JDM601_2274 (tpiA)
Exosome [BR:mjd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   JDM601_2274 (tpiA)
  Exosomal proteins of bladder cancer cells
   JDM601_2274 (tpiA)
  Exosomal proteins of melanoma cells
   JDM601_2274 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEF36274
UniProt: F5YUP3
Position
complement(2474059..2474844)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKVAFSLPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLTFGAQDLSQHDAGAYTGEISGAFLAKLGCSYVVVGHSERRSYHGEDDALVAAKAAA
ALKHGLTPIICVGEHLEIREAGNHVEYCVDQLRGSLSGLSAEQIGASVIAYEPVWAIGTG
RVAGAADAQEVCAAIRAELGKLASPKIAEAVRVLYGGSVNAKNIGELIAQPDVDGGLVGG
ASLDGEQFATLAALAAGGPLV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaaaccgctgatcgccggcaactggaagatgaatctcaaccacttcgaggcg
atcgcactggtgcagaaggtggcgttctcgctgccggacaagtattacgacaaggtcgac
gtcacggtgctgccgccgttcaccgacctgcgtagtgtgcagacgctggtcgacggggac
aagcttcggctgaccttcggcgcccaggacctctcgcagcacgacgcgggcgcctacacc
ggcgagatcagcggggcgttcctggccaagctgggctgcagctacgtcgtcgtcggccac
tccgaacggcgcagctaccacggcgaggacgacgcgctggtggccgccaaggccgccgct
gcgctcaagcacgggctcaccccgatcatctgcgtcggcgaacacctcgagatccgggaa
gccggcaaccacgtcgagtactgcgtggaccagctgcgcggctcgctgtccgggctgagc
gccgaacagatcggtgcgagcgtcatcgcctacgaaccggtgtgggcgatcggcaccggc
cgggtcgccggtgccgccgacgcccaggaggtgtgcgcggcgatccgcgccgaactgggc
aagctcgcctccccgaagatcgccgaggcggtacgggtgctctacggcggctcggtcaac
gccaagaacatcggcgaactcatcgcccagcccgacgtcgacggcggtctggtcggcggg
gcgtcgttggacggcgagcagttcgccaccttggcggcgctggcggccggcgggcccctt
gtctag

DBGET integrated database retrieval system