KEGG   Mycobacterium sinense: JDM601_2443Help
Entry
JDM601_2443       CDS       T01512                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase PpgK
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mjd  Mycobacterium sinense
Pathway
mjd00010  Glycolysis / Gluconeogenesis
mjd00520  Amino sugar and nucleotide sugar metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM601_2443 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    JDM601_2443 (ppgK)
Enzymes [BR:mjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     JDM601_2443 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEF36443
UniProt: F5YW32
Position
2639856..2640674
Genome map
AA seq 272 aa AA seqDB search
MTGTDPTDSPPVAPAAATGDGRPQRRGFGVDVGGSGIKGGVVDLDTGALIGERYKLPTPS
PATPAAVAETVAQVVRKFGWTGPLGVTYPGVVIDGVVRTAANVDKSWIGVNAQAAIQAAL
DGQPVVILNDADAAGLAEERFGAGKDNTGVVVLLTFGTGIGSAVIHNGKLLPNTELGHID
VAGKEAEHRAAASVKERKNWSMKKWSKQVTKVLVAIEDALCPDLIIAGGGISRKADEWVP
LLRNRTPVVAATLQNTAGIVGAAMAATADVTR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcacagacccgaccgattccccgcccgtcgcgcccgctgccgcgaccggcgac
gggcgaccgcaacgacgcggtttcggcgtcgatgtcggcggcagcggcatcaaaggcggc
gtggtcgacctcgacaccggtgcactgatcggcgaacgctacaaactgccgacaccgagc
cccgcgacccccgccgcagtcgccgagaccgtcgcccaggtggtccggaagttcggctgg
accggtccgctgggggtcacctaccccggtgtggtgatcgacggcgtggtgcggaccgcc
gccaacgtcgacaagtcctggatcggggtgaacgcgcaagccgcgatccaggccgcgctc
gatgggcagcccgtcgtcatcctcaacgacgccgacgccgccggactggccgaagagcgg
ttcggcgcgggcaaggacaacaccggcgtcgtcgtgttgctcaccttcggcaccgggatc
ggctcggcggtgatccacaacggaaagctgctacccaacaccgaactcgggcacatcgac
gtggccggcaaggaggccgagcaccgggccgcggcgtcggtcaaggagcgcaagaactgg
agcatgaagaagtggtccaagcaggtgaccaaggtgttggtggcgatcgaggacgcgctg
tgcccggacctgatcatcgcgggcggcggcatcagccgcaaagccgacgaatgggtgcca
ctgctgcgcaaccggactccggtggtcgccgccacattgcagaacaccgccgggatcgtc
ggggccgcgatggccgccacggccgacgtgacccgctga

DBGET integrated database retrieval system