KEGG   Mycobacterium sp. JDM601: JDM601_2443Help
Entry
JDM601_2443       CDS       T01512                                 

Gene name
ppgK
Definition
polyphosphate glucokinase PpgK
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mjd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mjd00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mjd00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2639856..2640674
Genome map
AA seq 272 aa AA seqDB search
MTGTDPTDSPPVAPAAATGDGRPQRRGFGVDVGGSGIKGGVVDLDTGALIGERYKLPTPS
PATPAAVAETVAQVVRKFGWTGPLGVTYPGVVIDGVVRTAANVDKSWIGVNAQAAIQAAL
DGQPVVILNDADAAGLAEERFGAGKDNTGVVVLLTFGTGIGSAVIHNGKLLPNTELGHID
VAGKEAEHRAAASVKERKNWSMKKWSKQVTKVLVAIEDALCPDLIIAGGGISRKADEWVP
LLRNRTPVVAATLQNTAGIVGAAMAATADVTR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcacagacccgaccgattccccgcccgtcgcgcccgctgccgcgaccggcgac
gggcgaccgcaacgacgcggtttcggcgtcgatgtcggcggcagcggcatcaaaggcggc
gtggtcgacctcgacaccggtgcactgatcggcgaacgctacaaactgccgacaccgagc
cccgcgacccccgccgcagtcgccgagaccgtcgcccaggtggtccggaagttcggctgg
accggtccgctgggggtcacctaccccggtgtggtgatcgacggcgtggtgcggaccgcc
gccaacgtcgacaagtcctggatcggggtgaacgcgcaagccgcgatccaggccgcgctc
gatgggcagcccgtcgtcatcctcaacgacgccgacgccgccggactggccgaagagcgg
ttcggcgcgggcaaggacaacaccggcgtcgtcgtgttgctcaccttcggcaccgggatc
ggctcggcggtgatccacaacggaaagctgctacccaacaccgaactcgggcacatcgac
gtggccggcaaggaggccgagcaccgggccgcggcgtcggtcaaggagcgcaagaactgg
agcatgaagaagtggtccaagcaggtgaccaaggtgttggtggcgatcgaggacgcgctg
tgcccggacctgatcatcgcgggcggcggcatcagccgcaaagccgacgaatgggtgcca
ctgctgcgcaaccggactccggtggtcgccgccacattgcagaacaccgccgggatcgtc
ggggccgcgatggccgccacggccgacgtgacccgctga

DBGET integrated database retrieval system