KEGG   Mycobacterium sp. JDM601: JDM601_2488Help
Entry
JDM601_2488       CDS       T01512                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    JDM601_2488
Enzymes [BR:mjd01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     JDM601_2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2680174..2680611
Genome map
AA seq 145 aa AA seqDB search
MTDPSVHDSAVDNIRTVETFLDALADDDLDTAADALAEDVVYHNVGLPTIYGRSATVGVF
RRMSGRAGFEVKVHRIAADGSAVLTERTDALTFGPLRLQFWVCGVFEVHNGRITLWRDYF
DFLDMFKATLRAVAATVFPALRPTL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccgagtgtccacgacagcgccgtcgacaacatccgaaccgtggagaccttc
ctcgacgccctcgccgacgacgatctcgacacggcggccgacgccctggccgaggacgtg
gtgtaccacaacgtcgggctgccgaccatctacggccgcagcgccaccgtcggggtgttc
cgccggatgtccggccgcgcgggcttcgaggtgaaggtccaccgcatcgccgccgacggc
tcggcggtgctcaccgagcgcaccgacgccctgaccttcggcccgctgcggctgcagttc
tgggtgtgcggggtgttcgaggtgcacaacgggcgtattacgttgtggcgcgactacttt
gactttctggatatgttcaaggcgacgttgcgcgcggtggcggcgactgtcttcccggca
ctgcgcccgacgttgtag

DBGET integrated database retrieval system