KEGG   Mycobacterium sp. JDM601: JDM601_2509Help
Entry
JDM601_2509       CDS       T01512                                 

Gene name
dfrA
Definition
dihydrofolate reductase DfrA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mjd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mjd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2698677..2699159)
Genome map
AA seq 160 aa AA seqDB search
MTALGLIWAQSTSGVIGRDGGIPWRLPEDQARFKELTLGHRVVMGRLTWESLPAGVRPLP
GRANVVVSRRSDYRAVGAEVVPTLDAALTDAETWVIGGAQIYALALPLADRCEVTEVEID
LPRQDEDAVAPVLDESWRGTAGPWLTSARGLRYRFCSYHR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgctcgggctgatctgggcccagtcgacgtccggggtgatcgggcgtgacggc
ggcatcccgtggcggctgcccgaagaccaggcgcgtttcaaggaactcaccctgggacac
cgggtggtgatgggccggttgacctgggaatcgctgccggccggcgtgcgtccgctgccc
ggccgggccaacgtggtggtcagccgccggagcgactaccgcgccgtcggggccgaggtg
gttccgaccctcgacgcggcgctgaccgatgccgagacctgggtgatcggcggggcgcag
atctacgcgctggcgctgccgctggccgaccggtgcgaggtgaccgaggtggagatcgac
ctgccccggcaagacgaggacgccgtcgcaccggtgctcgacgaaagctggcggggcacc
gcggggccgtggctcaccagcgcgcgcggcctgcggtaccggttctgcagctaccaccgc
tga

DBGET integrated database retrieval system