KEGG   Mycobacterium sp. JDM601: JDM601_2646Help
Entry
JDM601_2646       CDS       T01512                                 

Gene name
celA
Definition
cellobiohydrolase a CelA
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    JDM601_2646 (celA)
Enzymes [BR:mjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     JDM601_2646 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2829901..2830758)
Genome map
AA seq 285 aa AA seqDB search
MPFYVDPISKAMHASNAQPDSAELARVANTPQAYWLDQAFGVGSVGSTVARHTGAAAAAG
AMPVLVLYAIPHRDCGSYAAGGFSSGASYRAWIDGIADGIGGSPAAIVLEPDALAMADCL
SGDQRQERFDLISYAVDTLGRNPATAVYVDAGHSRWVNAGEMANRLNQAGVARARGFALN
STNYFTTEEQIGYGEEISGMTGGKHYVIDTSRNGVGPAEGDPYGWCNPSGRALGTPPTTD
TAGAHADAYLWVKRVGESDGSCGAGEPAAGHFVSEYAINLARNAG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctatgtcgatcccatctcgaaggcgatgcatgcctccaacgcgcagccggac
agcgccgaactggcccgggtcgccaacacaccgcaggcgtactggctcgaccaggcgttc
ggcgtgggatctgtcggctcgacggtggcccggcacaccggggcggcggctgcggccggt
gccatgccggtgctggtgctctacgccatcccgcaccgcgactgcggcagctacgccgcc
ggcggcttctcatccggtgcgtcctaccgcgcctggatcgacggcatcgccgacggcatc
ggtggttcgccggccgcgatcgtcctggaaccggacgcgctggccatggccgactgcctc
tccggagaccagcgccaggagcgcttcgacctgatcagctacgccgtcgacacgctcgga
cgcaacccggccaccgccgtctacgtcgacgccgggcactcgcgctgggtcaacgccggt
gaaatggccaaccgcctcaaccaggccggcgtggcacgtgcgcggggcttcgcgctcaac
tccacgaactacttcaccaccgaagagcagatcggctacggcgaagagatctccggcatg
acgggcggcaagcactacgtgatcgacacctcccgcaacggggtcggtcccgccgaaggc
gatccgtacggctggtgcaacccgagtggacgcgccctcggtacgccgccgaccaccgac
accgccggcgcgcacgccgacgcttacctgtgggtcaagcgggtcggggagtccgacggc
agttgcggcgccggcgaacccgccgccgggcacttcgtcagcgagtacgccatcaacctg
gcgcgtaacgccggctga

DBGET integrated database retrieval system