KEGG   Mycobacterium sp. JDM601: JDM601_2751Help
Entry
JDM601_2751       CDS       T01512                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    JDM601_2751
Enzymes [BR:mjd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     JDM601_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2933724..2935253
Genome map
AA seq 509 aa AA seqDB search
MTEKPSVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAAYLPLMRVLRTLAAEGRRN
LLTLGVTPVVAAQLDDPYCLDGMHHWLANWQLRATQATTLPDLRDFGRHECAKAEQALDD
FALLWRHGASPLLRELTQAGTVEMLGGPLAHPFQPLLAPRLREFALREGLADTRARLAQR
PTGIWAPECAYAPGMEAGYAAAGVTHFMVDGPSLHGDTALGRPVGDSGVIAFGRDLQVSY
RVWSPKSGYPGHGAYRDFHTYDHRTGLKPSRVTGRNVEPEHKAPYDPQRAEAAVDTHVAD
FVKVVRTRLQDESERIGRPAHVIAAFDTELFGHWWHEGPQWLARVLRALPEAGIRVGTLS
DAIDAGFVGDSVELPPSSWGSGKDWQVWSGEKVADLVQLNSEVVETALGAVDKAMAAAAT
PSGPSPRDRVADQILREALLTVSSDWPFMVSKDSAAEYARYRAQLHAHATREIADALASG
HRDAAERLAEGWNRADGLFGALDARRLPR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaaagccttcggtgccgggtctgttcaccctggttctgcacacccatctaccc
tggctggcccaccacggccgctggccggtcggcgaggagtggctctaccagtcctggtcg
gcggcttacctgccgctgatgcgggtgctgcggacgctggccgccgaaggccgccgcaac
ctgctcaccctcggggtgacgccggtggtcgcggcccagctcgacgacccgtactgcctc
gacggcatgcaccattggctggcgaactggcagctgcgcgccacccaggccacgacgctg
ccggatctgcgtgacttcggccggcacgagtgcgccaaggccgagcaggcgctcgacgat
ttcgcgctgctgtggcgccacggcgccagccccttgctgcgcgagctgacccaggccggc
accgtcgagatgctgggcggcccgctggcccacccgttccagccgctgctggcgccgcgg
ttgcgggagttcgcgctgcgggagggcttggccgacacccgggcgcggctggcgcagcgc
cccaccgggatctgggcgccggagtgcgcctatgcccccggcatggaggccggttacgcg
gcggccggagtgacgcacttcatggtcgacgggccgtcgctgcacggcgacaccgcgctg
ggccgaccggtcggtgactcgggagtgatcgcgttcggtcgcgacctgcaggtcagctac
cgggtctggtcgcccaagtcgggctatccgggccacggcgcctaccgggatttccacacc
tacgaccatcgcaccgggctgaagccgtcacgggtcaccggccgcaacgtcgaaccggaa
cacaaggcgccctacgacccgcagcgcgccgaggccgccgtcgacacccacgtcgccgat
ttcgtcaaggtggtccgcacccggctgcaggacgaatcggaacgaatcggccggcccgcc
catgtgatcgccgccttcgacaccgagctgttcggccactggtggcacgagggaccgcag
tggctggcccgggtgttgcgggcgctgccggaggccgggattcgcgtcggcacactgtcg
gacgcgatcgacgccgggttcgtcggggactcggtcgagctgcccccgagctcgtggggc
tcgggcaaggactggcaggtgtggtccggggagaaggtcgccgacctggtgcagctcaac
agcgaggtggtcgagaccgcgctgggcgccgtcgacaaggccatggcggctgccgccacg
ccgtcggggccgagtccgcgcgaccgcgtcgccgaccagattctgcgggaggcgttgctg
acggtgtccagcgactggccgttcatggtgagcaaggactccgccgccgagtacgcccgc
taccgcgcgcagttgcacgcccacgccacccgggagatcgccgacgcgctggcatccggg
caccgcgacgcggccgaacggctggccgagggctggaatcgggccgacggtctgttcggc
gcgctggatgcccgtaggctgccacggtga

DBGET integrated database retrieval system