KEGG   Mycobacterium sp. JDM601: JDM601_2751Help
Entry
JDM601_2751       CDS       T01512                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mjd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2933724..2935253
Genome map
AA seq 509 aa AA seqDB search
MTEKPSVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAAYLPLMRVLRTLAAEGRRN
LLTLGVTPVVAAQLDDPYCLDGMHHWLANWQLRATQATTLPDLRDFGRHECAKAEQALDD
FALLWRHGASPLLRELTQAGTVEMLGGPLAHPFQPLLAPRLREFALREGLADTRARLAQR
PTGIWAPECAYAPGMEAGYAAAGVTHFMVDGPSLHGDTALGRPVGDSGVIAFGRDLQVSY
RVWSPKSGYPGHGAYRDFHTYDHRTGLKPSRVTGRNVEPEHKAPYDPQRAEAAVDTHVAD
FVKVVRTRLQDESERIGRPAHVIAAFDTELFGHWWHEGPQWLARVLRALPEAGIRVGTLS
DAIDAGFVGDSVELPPSSWGSGKDWQVWSGEKVADLVQLNSEVVETALGAVDKAMAAAAT
PSGPSPRDRVADQILREALLTVSSDWPFMVSKDSAAEYARYRAQLHAHATREIADALASG
HRDAAERLAEGWNRADGLFGALDARRLPR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaaagccttcggtgccgggtctgttcaccctggttctgcacacccatctaccc
tggctggcccaccacggccgctggccggtcggcgaggagtggctctaccagtcctggtcg
gcggcttacctgccgctgatgcgggtgctgcggacgctggccgccgaaggccgccgcaac
ctgctcaccctcggggtgacgccggtggtcgcggcccagctcgacgacccgtactgcctc
gacggcatgcaccattggctggcgaactggcagctgcgcgccacccaggccacgacgctg
ccggatctgcgtgacttcggccggcacgagtgcgccaaggccgagcaggcgctcgacgat
ttcgcgctgctgtggcgccacggcgccagccccttgctgcgcgagctgacccaggccggc
accgtcgagatgctgggcggcccgctggcccacccgttccagccgctgctggcgccgcgg
ttgcgggagttcgcgctgcgggagggcttggccgacacccgggcgcggctggcgcagcgc
cccaccgggatctgggcgccggagtgcgcctatgcccccggcatggaggccggttacgcg
gcggccggagtgacgcacttcatggtcgacgggccgtcgctgcacggcgacaccgcgctg
ggccgaccggtcggtgactcgggagtgatcgcgttcggtcgcgacctgcaggtcagctac
cgggtctggtcgcccaagtcgggctatccgggccacggcgcctaccgggatttccacacc
tacgaccatcgcaccgggctgaagccgtcacgggtcaccggccgcaacgtcgaaccggaa
cacaaggcgccctacgacccgcagcgcgccgaggccgccgtcgacacccacgtcgccgat
ttcgtcaaggtggtccgcacccggctgcaggacgaatcggaacgaatcggccggcccgcc
catgtgatcgccgccttcgacaccgagctgttcggccactggtggcacgagggaccgcag
tggctggcccgggtgttgcgggcgctgccggaggccgggattcgcgtcggcacactgtcg
gacgcgatcgacgccgggttcgtcggggactcggtcgagctgcccccgagctcgtggggc
tcgggcaaggactggcaggtgtggtccggggagaaggtcgccgacctggtgcagctcaac
agcgaggtggtcgagaccgcgctgggcgccgtcgacaaggccatggcggctgccgccacg
ccgtcggggccgagtccgcgcgaccgcgtcgccgaccagattctgcgggaggcgttgctg
acggtgtccagcgactggccgttcatggtgagcaaggactccgccgccgagtacgcccgc
taccgcgcgcagttgcacgcccacgccacccgggagatcgccgacgcgctggcatccggg
caccgcgacgcggccgaacggctggccgagggctggaatcgggccgacggtctgttcggc
gcgctggatgcccgtaggctgccacggtga

DBGET integrated database retrieval system