KEGG   Mycobacterium sp. JDM601: JDM601_3011Help
Entry
JDM601_3011       CDS       T01512                                 

Gene name
fbiB
Definition
F420 biosynthesis protein FbiB
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    JDM601_3011 (fbiB)
Enzymes [BR:mjd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     JDM601_3011 (fbiB)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     JDM601_3011 (fbiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3219537..3220886
Genome map
AA seq 449 aa AA seqDB search
MTGPGEHGSAAKVEILPVTGLGEFRPGDDLAGALAQAAPWLADGDIVVVTSKVVSKCEGR
IVPAPHDPEARDALRRQLVEAEAVRVLARKGRTWITENRLGLVQAAAGVDGSNVGACELA
LLPVDPDGSAATLRARLAEQLGVDVAVLITDTMGRAWRHGQIDVAIGASGLTVLNGYAGA
VDRHGNELVVTEVAVADELAAAADLVKGKLTDVPVAVVRGVVSPDDGSTAAALVRSGPED
LFWLGTAEAIEAGRRQAQLLRRSVRAFSAEPVPAETITDAIAEALTAPAPHHTRPTRFVW
LQSPGVRTRLLDAMADKWRADLTGDGKSPEAVEARVARGRILYEAPEVVIPVMVPDGAHH
YPDATRTAAEHTMFTVAVGAAVQALLVALAVRGVGSCWIGSTIFTPDLVRAELDLPTDWE
PLGAIAIGYSVEPPEPRPPAAIDGLLVRR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggccccggcgaacacggcagtgccgcgaaggtcgagatcctgccggtcaccggc
ttgggcgagttccggccgggcgacgatctggcgggcgcgctggcgcaggccgcgccgtgg
ctggccgacggcgacatcgtggtcgtcaccagcaaggtggtgtccaagtgcgagggccgg
atcgttcctgctccccacgaccccgaggcgcgtgatgcgctgcgccgccaactggtcgag
gccgaggcggtgcgcgtactggcccgcaagggccgcacctggatcaccgagaatcggctc
ggactggtgcaggccgccgccggcgtggacggctccaacgtcggcgcgtgcgaactcgcg
ctgctgccggtcgaccccgacggcagcgccgcgacgttgcgcgcccggctggccgagcag
ctcggcgtcgacgtcgcggtgctgatcaccgacacgatgggccgcgcctggcgccatggg
cagatcgacgtcgcgatcggggcgtccggtctgaccgtgctcaacggctacgccggcgcc
gtcgaccggcacggcaacgagctggtcgtcaccgaggtggccgtcgccgacgaactggcg
gcggccgccgacctggtcaagggcaagctcaccgatgtcccggtggcggtggtgcgcggc
gtcgtcagtcccgacgacggatccaccgcggccgcgctggtgcgctccggacccgaggac
ctgttctggctcggcaccgccgaggccatcgaggcggggcgccggcaagcccagctgctg
cgccgctcggtgcgcgcgttctccgccgagccggtgccggcggagacgatcaccgacgcc
atcgccgaggcgctgaccgccccggcaccccaccacacccggccgacgcggttcgtctgg
ctgcagagcccgggcgtgcgcacccggctgctcgacgccatggccgacaagtggcgcgcc
gacctgaccggcgacggcaaatcccccgaggccgtcgaggcccgggtcgcgcgcggccgg
atcctctacgaggcacctgaagtcgtcatcccggtgatggtgcccgacggcgcccaccac
taccccgacgcgacccgcaccgccgccgaacacaccatgttcaccgtcgcggtcggtgcc
gcggttcaggcgctgctggtggcgctggcggtgcgcggtgtcggcagttgctggatcggg
tccaccatcttcacaccggatctggtacgggccgaactggatctaccgacggactgggaa
ccgttgggcgccatcgctatcggatacagcgtcgagccgcccgaaccccggccgccggct
gccatcgatggcctgctggtgcgtcggtga

DBGET integrated database retrieval system