KEGG   Mycobacterium sp. JDM601: JDM601_3076Help
Entry
JDM601_3076       CDS       T01512                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    JDM601_3076
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    JDM601_3076
Enzymes [BR:mjd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     JDM601_3076
Two-component system [BR:mjd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   JDM601_3076
Bacterial motility proteins [BR:mjd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    JDM601_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3279342..3279818
Genome map
AA seq 158 aa AA seqDB search
MAETPRPRNVVGVGASAGGVEARNSFTAELPATLPCAILVVLHMPAAAPACCRGSWIATA
PCRRSPPPPGPGWKHGRIYVAAPDHHLLVDDGRIVLTEGPTENGHRPAINALFPAMPQNA
IDAGLVDHQAPAAEIGVLLERPTGQSPGRHLSQAGCRT
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaactcctcgcccccgcaacgtcgtcggcgtgggggcgtcggccggtggtgtc
gaggcgcggaacagtttcacagccgaactgccggcgacgctgccttgtgcgattctggtc
gtgttgcacatgccggccgcagccccggcgtgctgtcgcggatcctggatcgccacagca
ccttgccggcggtcaccgccgccaccggggcccggctggaagcacggccgcatctatgtc
gccgcgcccgatcatcacctgctggtcgacgacggccggatcgtactcaccgaaggcccc
accgagaacgggcaccggccggcgatcaacgcgctgttcccggcgatgccgcagaatgcg
atcgacgccgggctggtcgatcaccaagcgccggccgccgagatcggcgtgctgctggaa
aggccgaccgggcagtcgcctggccgccatctatcacaggcaggatgccggacctga

DBGET integrated database retrieval system