KEGG   Mycobacterium sp. JDM601: JDM601_3076Help
Entry
JDM601_3076       CDS       T01512                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mjd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3279342..3279818
Genome map
AA seq 158 aa AA seqDB search
MAETPRPRNVVGVGASAGGVEARNSFTAELPATLPCAILVVLHMPAAAPACCRGSWIATA
PCRRSPPPPGPGWKHGRIYVAAPDHHLLVDDGRIVLTEGPTENGHRPAINALFPAMPQNA
IDAGLVDHQAPAAEIGVLLERPTGQSPGRHLSQAGCRT
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaactcctcgcccccgcaacgtcgtcggcgtgggggcgtcggccggtggtgtc
gaggcgcggaacagtttcacagccgaactgccggcgacgctgccttgtgcgattctggtc
gtgttgcacatgccggccgcagccccggcgtgctgtcgcggatcctggatcgccacagca
ccttgccggcggtcaccgccgccaccggggcccggctggaagcacggccgcatctatgtc
gccgcgcccgatcatcacctgctggtcgacgacggccggatcgtactcaccgaaggcccc
accgagaacgggcaccggccggcgatcaacgcgctgttcccggcgatgccgcagaatgcg
atcgacgccgggctggtcgatcaccaagcgccggccgccgagatcggcgtgctgctggaa
aggccgaccgggcagtcgcctggccgccatctatcacaggcaggatgccggacctga

DBGET integrated database retrieval system