KEGG   Mycobacterium sp. JDM601: JDM601_3141Help
Entry
JDM601_3141       CDS       T01512                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    JDM601_3141 (deoA)
Enzymes [BR:mjd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     JDM601_3141 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3340784..3342088)
Genome map
AA seq 434 aa AA seqDB search
MNRSFDAPTLIAAKRDGHRLPDAAIDWLIDSYTAAEIAEEQMAALLMAIFLRGMDAEETA
RWTAAMIASGERMDFRELRRDGRRVPTVDKHSTGGVGDKITLPLVAVVAACGAAVPQASG
RGLGHTGGTLDKLESIAGFDPVLPTARLREQLAEVGAAIFAAGALAPADAKLYALRDITA
TVESLPLIASSVMSKKLAEGTGALVLDVKVGSGAFMKSAGPARQLAELMIELGAAHGVPT
RALLTDMNSPLGATVGNALEVAEALDVLAGGGPEDVVALTLALATEMLELAGLDDREPAA
TLADGTAMDAFAAMVAAQGGDLSVALPVAACSETVTAPRDGTMGEIDAMAVGMTAWRLGA
GRSRPGERVQAGAGVRIHRRPGEPVSAGEALFTLYTDAPERFGPAHAELDGGYRILSGPD
AAPVPRPLIIGAAP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgctcctttgacgccccgacgctgatcgccgccaagcgcgacggtcaccggctg
cccgacgccgcgatcgactggctgatcgactcctacacggccgccgagatcgccgaagag
cagatggcggcgctgttgatggcgatcttcctgcgtggcatggacgccgaagagaccgcg
cgctggaccgcggcgatgatcgcctccggggagcggatggactttcgcgagctgcggcgc
gacgggcgccgggtgcccaccgtcgacaaacactccaccggcggggtgggcgacaaaatc
acgttgccgctggtcgcggtggtcgccgcctgcggtgccgcggtgccgcaggcctccggc
cgcggtctgggccacaccggcggcacgctggacaagctggagtcgatcgcgggtttcgac
ccggtgctgccgacggcccggctgcgcgagcagctcgccgaggtcggggcggcgatcttc
gccgccggtgccctggcgccggccgacgccaagctgtatgcgctgcgggacatcaccgcc
accgtggagtcgctgccgctgatcgccagctcggtgatgagcaagaaactggccgaagga
actggtgcactggtccttgatgtcaaggtcggctcgggcgccttcatgaagtcggccggt
ccggcccggcagcttgccgagctgatgatcgagctgggtgcggcccacggcgtgccgacc
cgcgccctgctcaccgacatgaacagcccgctcggcgcgaccgtcggcaacgccctggag
gtcgccgaggcactcgacgtgctggcgggcggcgggcccgaggacgtggtggcgctcacg
ctcgcgctggccaccgagatgctggagctggccgggttggacgaccgtgagccggccgcg
acgttggccgacggcaccgcgatggacgccttcgccgcgatggtcgccgcccagggcggg
gatctgagcgttgcgctgccggtggcggcgtgctcggagacggtcaccgcaccccgggac
ggcacaatgggggaaatcgacgcgatggcggtgggtatgacggcatggcggctgggagcg
gggcgctcccgcccgggtgaacgtgtgcaggccggcgccggcgtgcgcatccaccgtcgg
ccgggggagccggtcagcgccggcgaggcgctgttcacgctgtacaccgatgctcccgag
cggttcgggccggcgcacgccgagctcgacggcggctaccggatcctgagcggcccagac
gccgcgcccgtcccgcgcccactgatcatcggagcggccccatga

DBGET integrated database retrieval system