KEGG   Mycolicibacter sinensis: JDM601_3144Help
Entry
JDM601_3144       CDS       T01512                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00020  Citrate cycle (TCA cycle)
mjd00190  Oxidative phosphorylation
mjd00650  Butanoate metabolism
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
Module
mjd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mjd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mjd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JDM601_3144 (sdhD)
   00650 Butanoate metabolism
    JDM601_3144 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    JDM601_3144 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AEF37144
UniProt: F5Z3R6
Position
3343128..3343595
Genome map
AA seq 155 aa AA seqDB search
MSTPDLQLGRGALAPVRGPDRDRPASLGDPRAPFRHKGMANFEKYTWLFMRFSGAVLIFL
VLGHLFIMLMWDDGVYRIDFNFVAERWRSPFWQIWDLSLLWLAQLHGGNGMRTIISDYTR
SGRSRFWLLSLLAVSMVFTLALGSYVLLSFDPNIS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacctgatctgcaactcggccgcggcgcgctggccccggtgcgcggcccggac
cgcgaccggcccgccagcctgggcgacccgcgcgcgccgttccggcacaaggggatggcc
aacttcgagaagtacacctggctgttcatgcggttctccggcgccgtactgatcttcctg
gtgctcgggcacctgttcatcatgctgatgtgggacgacggggtgtaccggatcgacttc
aacttcgtggccgagcgctggcgctcgccgttctggcagatctgggacctcagcctgctg
tggctggctcagctgcacggcggcaacggcatgcgcaccatcatcagtgactacacccgc
agcggccgcagccggttctggctgctgagcctgctggcggtgtcgatggtcttcacgctg
gcgctgggcagctacgtgctgctgagcttcgacccgaacatttcttga

DBGET integrated database retrieval system