KEGG   Mycobacterium sp. JDM601: JDM601_3147Help
Entry
JDM601_3147       CDS       T01512                                 

Definition
steroid dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mjd  Mycobacterium sp. JDM601
Brite
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     JDM601_3147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3346354..3347145
Genome map
AA seq 263 aa AA seqDB search
MHWYTGNSGYDTVLTFAFGFAAFVIIGGFFGQSSYGRFSSAKLGFNLNPKFGWWLMEIPA
TVVFLVAYLCGPARFEPTSLVLAGIWALHYANRGWFFPLAIRQVPGKRSTFNISVVVMGM
LVTTMHGYLNGALFSHDYLGQYSRSWLTDPRFVVGLVIYLCGFALLVSSESIVRNLRDKN
NPGAAEYRIPFGGGFRFVTSPAYLGEIIAWTGFAILTWALPGVVILLITAGNLIPRALQT
HRWYREKFADYPTDRKALVPFLL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcactggtacaccggcaacagcggctatgacaccgtcctgaccttcgcgttcggcttc
gccgcattcgtgatcatcggcggcttcttcggccagagctcgtacggccggttctcctcg
gccaagctcggcttcaacctgaacccgaagttcggctggtggctgatggagatcccggcg
acggtggtgttcttggtcgcatacctgtgcgggccggcccggttcgagccgacgtcgctg
gtgctggccgggatctgggcgctgcactacgccaaccgcggctggttcttcccgctggcg
atccggcaggtgcccggcaagcgcagcacgttcaacatctcggtggtggtgatgggcatg
ctggtcacgaccatgcacggctacctcaacggtgcgctgttcagccacgactacctgggg
cagtacagccgttcctggctgaccgacccgcgtttcgtggtgggcctggtgatctacctg
tgcgggttcgcgctgctggtcagctccgagtcgatcgtgcgcaacctgcgcgacaagaac
aacccgggtgctgccgagtaccggatcccgttcggcggcggcttccggttcgtcaccagc
ccggcctacctgggcgagatcatcgcctggacgggtttcgcgatcctgacctgggcgctg
cccggtgtggtgatcctgctgatcaccgccggcaacctgatcccgcgcgcgttgcagacc
caccgctggtaccgggagaagttcgccgactatcccaccgaccgcaaggcactggtgccg
ttcctgctctga

DBGET integrated database retrieval system