KEGG   Mycobacterium sp. JDM601: JDM601_3167Help
Entry
JDM601_3167       CDS       T01512                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mjd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3364882..3366858
Genome map
AA seq 658 aa AA seqDB search
MQQLYPFPAVLGGDPDAPGGLDDMALALVLSAISPGIGGVLIRGEKGTAKSTLVRALAQV
LPAIDVVAGDRFSSDPAEPNPLSPDGPFPADAAVQTRPVRLVELPVGATEDRVVGSIHLE
RALGSGAVEFEPGLLARANRGILYVDEVNLLADHLVDLLLDAAAMGRLTVERDGVSVSHA
ARFVIVGTMNPEEGELRPQLLDRFGLTVEVSAPRDPALRAEAVRRRLAFDADPEAFARDY
ADAEERLRARIRNAQELLPRVELTDAALVRIGEICAAFDVDGLRGDIVCARTAVAHAAWQ
GRDAVNIEDLRVAARLALPHRRRRKPFDAPGLDETELDELLPPQDSGPEPDPDPDGPEPD
GPPDGGNAAQPEQRGPAPAKTGATSTVGADSPYRARLFTVDGVGSGRAGRRSRARTSSGR
RVGATAVGAAGGLHLFETLRAAAPHQGARGRVDGPMLLQAADLRRAVREGREANLVLFVV
DTSGSMAAAERMRHVKTAILSLLLDAYRRRDRVAVVTFRDTGAQVALPATGSVEIAAVRL
DELPAGGRTPLAEGLLEAGEVIRRERLRDPASRPLLVVLTDGRATAGADPVERSRQAALQ
LAEHGFSAVVVDCESGRMRLGLARTLAEQLRADYVPLPQVSAEALSGIVRDVTGKGAA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagctgtacccgtttcctgccgtgctcggcggcgacccggacgctccgggcggc
ctcgacgacatggccttggcgctcgtgctgagcgcgatctcccccggcatcggcggggtt
ctcatccgcggcgagaagggcacggccaagtcgacgctggtacgggcgctggcccaggtg
ctccccgccatcgacgtggtggccggcgaccggttctcctccgatcccgcagagccgaac
ccgctctccccggacggcccgttccccgccgacgccgccgtgcagacccgcccggtgcgg
ctggtggagcttccggtcggcgccaccgaggaccgggtggtcggctccatccatctggaa
cgagcgctggggtccggcgccgtggagttcgagcccggcctgctggcgcgtgccaaccgc
ggcatcctctacgtcgacgaggtcaacctcctcgccgaccacctggtggacctgttgctg
gacgccgccgccatgggccggctgaccgtggaacgcgacggggtctcggtcagccacgcc
gcacgtttcgtgatcgtcgggacgatgaaccccgaggagggcgagctgcgcccgcagttg
ctcgaccgattcgggctgacggtcgaggtgtccgcgccgcgcgatccggcgctgcgcgcc
gaggcggtccgccggcggttggcgttcgacgccgatcccgaggccttcgcccgcgactac
gccgacgccgaggagcggctgcgagcccggatccgcaatgctcaggagctgctgccgcgg
gtggagctcaccgacgccgcgctggtgcggatcggcgagatctgtgcggctttcgacgtc
gacggcctgcgcggcgacatcgtgtgtgcccgtaccgcggtcgcgcacgccgcctggcag
gggcgcgacgcggtcaacatcgaggatctgcgggtggccgcccggctggccctgccgcat
cggcgccggcgcaagccatttgacgccccggggctcgatgaaaccgagctcgacgagctg
ctgccgccgcaggattccggcccggagccagacccggatcccgacggccccgagcccgac
ggtccgccggacggcggcaacgccgcgcaacccgagcagcgcgggcccgcgccggcaaaa
accggcgccacctcgaccgtcggcgctgactccccttaccgggcacggcttttcaccgtc
gacggggtcggctccggccgtgccggccggcgcagccgggcccgcaccagttccgggcgc
cgcgtgggtgccaccgccgtcggcgccgccgggggcctgcacctgttcgagacgctgcgg
gccgccgccccgcatcagggcgcccgaggccgggtcgacggcccgatgctgctgcaggcc
gccgatcttcgccgcgccgtccgggagggccgggaggccaacctggtgctgttcgtcgtg
gacacctccggctcgatggccgccgccgagcggatgcggcacgtcaagaccgcgatcctg
tcgctgttgctcgacgcctaccgccgccgggaccgggtggcggtggtgacgttccgcgac
accggagcgcaagtggcactgcccgcgaccgggtcggttgagatcgccgcggtgcgcctc
gacgagctgcccgccggtggccgcacgccgctggccgagggactgctcgaggccggtgag
gtgatccgccgggaacggctgcgcgacccggcgtcacgcccgctgctggtggtgctgacc
gacggccgggccaccgccggcgccgacccggtcgagcggtcgcggcaggccgcgctgcag
cttgccgaacatgggttttccgccgtcgtcgtcgattgtgagagcggccggatgcggctc
gggttggcgcgcaccctggccgagcagctgcgggccgactacgtgccgctgccgcaggtc
agtgccgaggcgctcagcggcattgttcgtgacgtcactggaaagggggccgcctga

DBGET integrated database retrieval system