KEGG   Mycolicibacter sinensis: JDM601_3619Help
Entry
JDM601_3619       CDS       T01512                                 

Gene name
echA13_1
Definition
(GenBank) enoyl-CoA hydratase EchA13_1
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00071  Fatty acid degradation
mjd00280  Valine, leucine and isoleucine degradation
mjd00281  Geraniol degradation
mjd00310  Lysine degradation
mjd00360  Phenylalanine metabolism
mjd00362  Benzoate degradation
mjd00380  Tryptophan metabolism
mjd00410  beta-Alanine metabolism
mjd00627  Aminobenzoate degradation
mjd00640  Propanoate metabolism
mjd00650  Butanoate metabolism
mjd00903  Limonene and pinene degradation
mjd00930  Caprolactam degradation
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01120  Microbial metabolism in diverse environments
mjd01130  Biosynthesis of antibiotics
mjd01212  Fatty acid metabolism
Module
mjd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    JDM601_3619 (echA13_1)
   00650 Butanoate metabolism
    JDM601_3619 (echA13_1)
  Lipid metabolism
   00071 Fatty acid degradation
    JDM601_3619 (echA13_1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JDM601_3619 (echA13_1)
   00310 Lysine degradation
    JDM601_3619 (echA13_1)
   00360 Phenylalanine metabolism
    JDM601_3619 (echA13_1)
   00380 Tryptophan metabolism
    JDM601_3619 (echA13_1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JDM601_3619 (echA13_1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    JDM601_3619 (echA13_1)
   00281 Geraniol degradation
    JDM601_3619 (echA13_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JDM601_3619 (echA13_1)
   00627 Aminobenzoate degradation
    JDM601_3619 (echA13_1)
   00930 Caprolactam degradation
    JDM601_3619 (echA13_1)
Enzymes [BR:mjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     JDM601_3619 (echA13_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEF37619
UniProt: F5Z1G3
Position
complement(3824860..3825780)
Genome map
AA seq 306 aa AA seqDB search
MATSETTSAQAGDLVDYEILDDGRIARIWLNRPETHNAQNRTLLVQLDEAFGRAEADDAV
RVVILAARGENFSAGHDLGSEAALAERRAGPGQHPSFRSHGGTREPVVEKTYLQEWHYYF
SNTCRWRELRKITIAQVQGNAISAGLMLIWACDLIVAADDARFSDVVGVRLGMPGVEYYA
HPWEFGPRKAKELLLTGDSLDADEAYRLGMVSKVFSVEELEDKTLEFARRIAQLPTMAAL
LIKDSVNAAADAMGFSEALRHGFHIHQLGHAHWAAHNDNKFPVALPPEVPDWRTAKATDV
ARRDQP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacatcggagaccacatcagcgcaggccggcgatctcgtcgactacgaaatcctt
gacgacggccgcatcgcccggatctggctgaaccgtccggagacacacaacgcgcagaac
cgcactctgctcgtgcagcttgacgaagcgttcggccgggccgaggccgacgacgccgtg
cgggtggtgatcctcgcggcgcgcggtgagaatttctccgccggccacgacctgggctcc
gaggcggccctggccgagcgccgggccgggccgggccagcacccgagtttccggagccac
ggcggcacccgggaaccggtcgtcgaaaaaacctacctgcaggagtggcactactacttc
tcgaacacctgccgctggcgggagctgcgcaagatcaccatcgcgcaggtgcagggcaat
gccatctccgccgggttgatgttgatctgggcgtgcgatctgatcgtcgctgccgacgac
gcccggttctccgacgtggtcggggtgcgcctgggcatgccgggcgtcgagtactacgcc
cacccgtgggagttcggcccgcgcaaggccaaggaactgctgctgaccggggactcgctg
gacgccgacgaggcctaccggctgggaatggtctcgaaggtgttcagcgtcgaggaactg
gaggacaagacattggagttcgcccgccgcatcgcgcagcttccgaccatggccgcgctg
ttgatcaaggactcggtgaacgccgccgccgacgccatgggcttttccgaggcgctgcgc
cacgggttccatatccatcaactgggccatgctcattgggcggcgcataacgacaacaag
tttccggtcgcgctgccgccggaggtaccggactggcgcaccgccaaggccacggacgtg
gcccgtcgcgaccagccgtag

DBGET integrated database retrieval system