KEGG   Mycobacterium sp. JDM601: JDM601_3640Help
Entry
JDM601_3640       CDS       T01512                                 

Definition
asparagine synthetase-like protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JDM601_3640
Enzymes [BR:mjd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     JDM601_3640
Peptidases [BR:mjd01002]
 Cysteine Peptidases
  Family C44
   JDM601_3640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3845181..3846974
Genome map
AA seq 597 aa AA seqDB search
MPPARPSLDGFLVTLPTETPVRVLGWPRFHRVGESAVWFHGFLASQASLRRELDLPKSAP
VAQIVVAGLRRWPTDAAERMVGEYAVVVVNGPDAVLFGDRMGLRPLYFAGGADGTVVSTD
LGALVRQTGAWHEPDEDYLADMFSTGLHLGPRTPYRGISRLQPGEFASCRAGRLRVRGGW
RPLAEPRHGTFDEHQELLRATVKHAVAGALSSDGTDAVELSGGLDTSTVLAVATGITPIP
ALSFVHPGSPGSDESSWIRAALRSTPAPWHPIDATEHGPFTAGPELGIFLPAPTRRILNW
APSAAEEAVARGLGATTILTGEGGDAVFFAGLLPWYLADLLRTGRWARLQRESLRWGAQS
ELGRSAAFWVRRAAIDGLRRWRSGRTLTLEPPRPIAASAPWLRQAYIERHRLQHRAQVTT
TVRAQSVHGQAVVENVLRCVEFARSRQLFAPEGIELRHPLLAPSLVDVAMTTPWDIAADP
RIDRAVQRYAFAGLVSETVLRRRSKSIADEAILHGFERNPRWREYLGSNPQIVQRGYVDA
EAWDSALRSAGRIGAVTQFYTAMQIEVWLRHLHYAADPTQRIAASEYFGPDSTEFET
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgccaccggcccggccatcactggatggattcctggtaacgctgcccaccgagacaccg
gtacgcgtcctcgggtggccccggtttcaccgcgtcggcgaatccgcggtgtggttccat
ggcttcctcgcgagccaggcatcgcttcgcagggagttggacctgccgaaatcggcaccc
gtggcgcagatcgtggtggccgggttgcggcggtggcccaccgacgcggccgaacgcatg
gtcggcgagtacgccgtagtggtggtgaacggccccgatgccgtcctgttcggggaccgc
atgggcctgcgtccgctgtacttcgccggcggggcggatggcaccgtggtctcgaccgac
ctcggcgccctggttcgccagaccggcgcctggcatgaacccgacgaggactacctggcc
gatatgttcagcaccggcttgcatctggggccccgaacgccgtatcgcggcataagccgg
ctacaacccggtgagttcgccagctgccgggcgggccgcttgcgggtacgaggtggttgg
cggcccctcgcggaaccgcgtcacggaaccttcgacgaacaccaggaactactgcgcgcg
accgtcaaacatgctgtcgcgggcgcattgtcgtctgacggtacggacgccgtcgagttg
tcgggcgggctggacacctcgaccgtcttggcggttgccaccggcatcactccgatacct
gcgctgagcttcgtccatcccggctccccgggcagcgacgagtcgtcttggattcgggca
gcccttcgatcgacgccggccccgtggcatccgatcgatgccaccgagcatgggcccttc
acggcggggccggaactgggcatctttctgccggcaccgacacgacggattctcaactgg
gcgcccagcgctgccgaggaggctgttgcgagggggctgggggcgacgacgattctgacc
ggcgaaggcggggacgccgtgttcttcgcgggcctgctcccctggtacctggccgacctg
ttgcgcaccggaagatgggcgcgactacagcgcgagtcgctgagatggggcgcccagtcc
gaactggggcgttccgccgcgttctgggtacggcgtgcggcgatcgacggactgcggcga
tggcgaagcggccggacgctcacgctggaaccaccccggcccatcgccgcatcggcaccg
tggttacgccaggcctacatcgagcgtcaccgcctgcagcaccgcgcacaggtcaccacg
accgtccgtgcgcagtcggtgcacggccaggccgtcgtggagaacgtcctgcgctgtgtc
gagttcgccagatcccgccagctgttcgcccccgagggcatcgaactgcgtcatccactg
ctggcgccttcactggtcgacgtggctatgaccacgccgtgggacatcgccgcagatcct
cggatcgaccgtgccgtgcaacggtacgcgttcgccgggctggtcagcgagaccgtactt
cgccggcgatcgaagtcgatcgccgacgaggcgatattgcacggctttgagcgcaacccc
cgctggcgcgaatacctcggctcgaatccgcagatcgtgcagcgcggctatgtcgacgcc
gaggcctgggacagcgcgctgcgctccgccggccgcatcggcgcggtgacccagttctac
accgcgatgcagatcgaggtctggctgcgccacctgcactatgcggccgacccgacacaa
cggattgccgcgtcagagtactttggtcccgattccacggagttcgagacatga

DBGET integrated database retrieval system