KEGG   Mycobacterium sp. JDM601: JDM601_3680Help
Entry
JDM601_3680       CDS       T01512                                 

Gene name
mhpF_1
Definition
acetaldehyde dehydrogenase MhpF
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mjd00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mjd00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mjd00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mjd00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mjd00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3887780..3888709)
Genome map
AA seq 309 aa AA seqDB search
MAAKASVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSAEGAD
WLLAQDELPDFVFEATSAYVHKAYAPKYEAAGIRAIDLTPAAVGPAVIPPANLHEHVDAP
NVNMITCGGQATIPIVYAVTRAVKEQGGTVPYAEIVASVASVSAGPGTRANIDEFTKTTS
RGVETIGGAQQGKAIIILNPADPPMIMRDTIFCQIPEDVDRDAITKSIHSVVEQVQTYVP
GYRLLNEPQFDEPSLNSGGRAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIARE
LATAKAGGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagcctcagtcgcgatcgtcgggtcgggcaacatcagcaccgacctgctg
tacaaactgctgcgctcggagtggctcgagccgcgctggatgatcggtatcgaccccgaa
tccgagggcctggcccgcgcccgcaaactcggtctggagacctcggcggagggggcggac
tggctgctggcccaagatgagttgccggacttcgtcttcgaggccaccagcgcctacgtc
cacaaggcgtacgcgcccaagtacgaggcggccggcatccgggccatcgacctgaccccg
gccgcggtcggcccggcggtgatcccgccggcgaacctgcacgaacacgtcgacgcgccc
aacgtcaacatgatcacctgcggcgggcaggccaccattccgatcgtctacgcggtgacc
cgcgcggtcaaagagcagggcggcacggtgccctatgccgagatcgtcgccagcgtcgcg
agcgtctcggcggggccgggcacccgggccaacatcgatgagttcaccaagaccacctcg
cgcggagtggagaccatcggcggtgcgcaacagggcaaggcgatcatcatcttgaacccg
gccgacccgccgatgatcatgcgcgacaccatcttctgccagattcccgaggacgtcgac
cgcgacgcgatcaccaagtcgatccacagcgtggtcgagcaggtgcagacctacgtgccc
ggctaccggctgctcaacgagccacagttcgacgagccgtcgctgaactccggcggccgc
gcggtcgtcaccaccttcgtcgaggtcgagggcgccggtgattacctgccgccgtatgcg
ggcaacctggacatcatgaccgccgcggcgaccaaggtcggcgaagagatcgcccgcgag
ctggcgaccgcgaaagccggaggggcgtaa

DBGET integrated database retrieval system