KEGG   Mycobacterium sp. JDM601: JDM601_3680Help
Entry
JDM601_3680       CDS       T01512                                 

Gene name
mhpF_1
Definition
acetaldehyde dehydrogenase MhpF
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    JDM601_3680 (mhpF_1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    JDM601_3680 (mhpF_1)
   00650 Butanoate metabolism
    JDM601_3680 (mhpF_1)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    JDM601_3680 (mhpF_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JDM601_3680 (mhpF_1)
   00622 Xylene degradation
    JDM601_3680 (mhpF_1)
   00621 Dioxin degradation
    JDM601_3680 (mhpF_1)
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     JDM601_3680 (mhpF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3887780..3888709)
Genome map
AA seq 309 aa AA seqDB search
MAAKASVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSAEGAD
WLLAQDELPDFVFEATSAYVHKAYAPKYEAAGIRAIDLTPAAVGPAVIPPANLHEHVDAP
NVNMITCGGQATIPIVYAVTRAVKEQGGTVPYAEIVASVASVSAGPGTRANIDEFTKTTS
RGVETIGGAQQGKAIIILNPADPPMIMRDTIFCQIPEDVDRDAITKSIHSVVEQVQTYVP
GYRLLNEPQFDEPSLNSGGRAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIARE
LATAKAGGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagcctcagtcgcgatcgtcgggtcgggcaacatcagcaccgacctgctg
tacaaactgctgcgctcggagtggctcgagccgcgctggatgatcggtatcgaccccgaa
tccgagggcctggcccgcgcccgcaaactcggtctggagacctcggcggagggggcggac
tggctgctggcccaagatgagttgccggacttcgtcttcgaggccaccagcgcctacgtc
cacaaggcgtacgcgcccaagtacgaggcggccggcatccgggccatcgacctgaccccg
gccgcggtcggcccggcggtgatcccgccggcgaacctgcacgaacacgtcgacgcgccc
aacgtcaacatgatcacctgcggcgggcaggccaccattccgatcgtctacgcggtgacc
cgcgcggtcaaagagcagggcggcacggtgccctatgccgagatcgtcgccagcgtcgcg
agcgtctcggcggggccgggcacccgggccaacatcgatgagttcaccaagaccacctcg
cgcggagtggagaccatcggcggtgcgcaacagggcaaggcgatcatcatcttgaacccg
gccgacccgccgatgatcatgcgcgacaccatcttctgccagattcccgaggacgtcgac
cgcgacgcgatcaccaagtcgatccacagcgtggtcgagcaggtgcagacctacgtgccc
ggctaccggctgctcaacgagccacagttcgacgagccgtcgctgaactccggcggccgc
gcggtcgtcaccaccttcgtcgaggtcgagggcgccggtgattacctgccgccgtatgcg
ggcaacctggacatcatgaccgccgcggcgaccaaggtcggcgaagagatcgcccgcgag
ctggcgaccgcgaaagccggaggggcgtaa

DBGET integrated database retrieval system