KEGG   Mycobacterium sp. JDM601: JDM601_3860Help
Entry
JDM601_3860       CDS       T01512                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    JDM601_3860 (malQ)
Enzymes [BR:mjd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     JDM601_3860 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4095217..4097232
Genome map
AA seq 671 aa AA seqDB search
MVPDDLRRLAAAHGVATCYRNERRELVQVDTDVVIRILRLLEVEAGTDTDRRRELARLDE
RDRAGAAPPAVAVRVAGCAQPMPGAAQLVSEDGERRTVRDELPADLAPGWYELALRDGRQ
VTLVAAPPRAPAAPATWGWMLQLYAVRSARSWGVGDLSDLRDWVRWTAGEHGAGAVLLNP
LHAPGPTHPVQPSPYTPSSRRFANPLALCIPDLAVYHRTDPDTRAEVDALRVAADTARID
YDLVWAAKRAALESLWRADGRPSPLDESPGNTALRDWATYCALAERHGGRWPKWPASLHD
AAGPAVAAARRELAPRIAFHAWVQQRCEEQLGAVQRAATDSGMTLGVLHDLAVGVDADGA
DAWALADVLAGAASVGAPPDTFSPHGQDWRLPPWRPDRLAATGYTAMRDMLRAVLAHADG
VRIDHVAGLWRLWWILPGESPDRGTYVHYDADVMLAVLALEAHRADAVVIGEDLGTVEPE
VTRTLAGNDMLGCAVSWFTRDESAPGQPLLPPAKWPAQVAASISTHDLPTAAGFLRAEHV
RARAERGLLDDAAAAQAAAERERAEWLALLRSEELLEPGGDADEAEIIDAMHRLLAATPS
RLKLISPYDVLAEPRQPNLPGTVDEYPNWRLPLRESFEQLRTDPRVARATALFSPGGASK
PGDVHDPPDGR
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcctgatgacctgcgccggctggcggccgcacacggcgtggcgacctgctatcgc
aatgaacggcgcgagctggtgcaggtcgacaccgacgtggtgatccggatacttcggctg
ctcgaagtcgaagcgggcaccgataccgaccggcgtcgcgagttggcccggctggacgag
cgcgatcgcgccggcgccgcaccgcccgcggtggcggtgcgggtggccggatgtgcgcag
ccgatgcccggggccgcccagctggtgagcgaggacggcgaacgccggacggtgcgcgac
gaactgcccgccgatctggcgccgggctggtatgagcttgcgctgcgcgatggccggcag
gtcacgctggtcgcggctccccctcgggcgccggcggcaccggcgacctggggatggatg
ctgcagctctacgcggtgcgatccgcccgttcgtggggtgtcggcgacctgtcggacctg
cgggactgggtgcgctggacggccggcgagcacggggccggggcggtgttgctcaacccg
ctgcacgccccgggcccgacgcatccggtgcagccgtcgccgtacacgccgtcgagccgg
cggttcgccaatccgctggcattgtgcatccccgacctcgcggtctatcaccgcaccgac
ccggacacccgggcggaggtcgatgcgctgcgggttgctgccgacacagcgcggatcgac
tacgacctggtctgggcggccaaacgggccgccctggagtcgctctggcgcgctgacggt
cgcccgtccccgctggacgaatcacccgggaacaccgcgttgcgcgactgggcgacctac
tgtgcgctggccgagcgtcacggcggccggtggccgaagtggccggcgtcgctgcacgat
gcggccggccccgccgtggcggccgcacgtcgggagctcgcaccgaggatcgcgtttcac
gcctgggtgcagcagcgctgcgaggaacaactgggggcggtgcagcgcgccgcaacggac
tcgggcatgacgctgggggtactgcacgacttggccgtcggcgtcgacgccgacggcgcc
gatgcctgggcactggccgacgtgctggccggtgcggccagcgtcggggcacccccggac
acgttcagcccgcacggtcaggactggcggctaccgccgtggcgaccggaccggttggcc
gccaccggctacaccgcgatgcgcgacatgctgcgtgccgtgctcgcccatgccgacggg
gtgcgcatcgatcacgtcgccggcctgtggcggctgtggtggatcctgcccggagaaagc
ccggatcgcggcacctacgtccactacgacgccgacgtcatgctggcggtgctggcgctg
gaagcccatcgcgccgatgctgtcgtcatcggcgaggatctgggcaccgtcgaaccggag
gtcacccggacgctggccggcaacgacatgctgggctgcgcggtctcttggttcacccgc
gacgaatcggcacccggccagccgctgctgccaccggcgaagtggccggcgcaggtggcc
gccagtatctccacccacgacctgcccaccgcggccggattcctgcgtgccgagcacgtc
cgggcccgcgccgagcggggcctgctcgacgacgcggcggccgcccaagccgcagccgag
cgcgaacgagccgagtggctggcgctgctgcgctccgaagagctgctcgagcccggcggc
gacgcggacgaagccgagatcatcgacgccatgcaccgcttgctggccgccaccccgagc
cggctgaaactcatctccccatatgacgtattggccgaaccccgccagcccaacctgccc
ggcaccgtcgatgaatatccgaactggcggctgccgctgcgcgagtctttcgaacagctg
cgcaccgatccgagagtcgcccgggccacggcattgttctcaccgggtggcgcgtcgaag
cccggcgacgttcacgatccccccgatggcaggtaa

DBGET integrated database retrieval system