KEGG   Mycobacterium sp. JDM601: JDM601_3898Help
Entry
JDM601_3898       CDS       T01512                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mjd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4134827..4135417)
Genome map
AA seq 196 aa AA seqDB search
MGSAMTSTGFDQARAEAAVRELLYAVGEDPDRAGLVDTPARVARAYQEMFAGLYTDPDTV
LETTFDEQHDEMVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGDDGRITGLSKLARVVDLY
AKRPQVQERLTGQVADALMRKLNPRGVIVVVEAEHLCMAMRGVRKPGAITTTSAVRGQFK
SDSASRAEALELIRRK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgggatcggcgatgacctcaacaggtttcgatcaagcgcgcgccgaagccgcggtgcgc
gaactgctgtacgcggtcggcgaagatccggaccgggcgggtctggtcgacaccccggcg
cgggtggccagggcgtaccaggagatgttcgccgggctctacaccgacccggacacggtg
ctggagaccaccttcgacgaacagcacgatgaaatggtgctggtcaaggagatcccgctg
tactcgacctgcgagcaccacctggtctcctttcacggcgtcgctcatgtcggctacatc
cccggcgacgacggccggatcaccggtttgtccaagctggcgcgggtggtggacctctac
gccaagcggccgcaggtgcaggagcggttgaccgggcaggtcgccgacgccctgatgcgc
aaactgaacccgcgcggggtcatcgtggtggtcgaggccgagcacttgtgcatggcgatg
cggggggtgcgcaagcccggtgcgatcaccacgacgtcggcggtgcgcggccagttcaag
tccgacagcgcgtcgcgcgccgaagccctggaactcatccggcgcaagtga

DBGET integrated database retrieval system