KEGG   Mycobacterium sp. JDM601: JDM601_3945Help
Entry
JDM601_3945       CDS       T01512                                 

Gene name
acs
Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mjd  Mycobacterium sp. JDM601
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mjd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mjd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mjd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mjd00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mjd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4193573..4195546
Genome map
AA seq 657 aa AA seqDB search
MSRNPDTAPADSPSSYPPSPEFTAHANTGAEAYRAAEHDRLAFWAEQANRLHWATPFTEV
LDYSRAPFARWFADGRLNVAYNCVDRHVAAGHGDRVAIHWAGEPANDARTITYAELLAEV
SRAANALTGLGLVAGDRVAIYLPMIPEAIIAMLACARLGVLHTVVFAGYSAHALRSRIDD
AQAKLVITSDGQFRRGQAAPLKPAVDEALSAAEATSTVEHVLVVRRTGAEVAWTPDRDLW
WHDVVDAASPQHSPEAFEAEQPLFLLYTSGTTGKPKGIVHTSGGYLTQAAYTHYCVFDLK
AATDVFWCTADIGWVTGHTYAVYGPLANGATEVIYEGTPDFPDQHRHFQIIEKYGVTIYY
TAPTLIRTFMKWGRDIPDAHDLSSLRLLGSVGEPINPEAWRWYRRVIGADAVPVVDTWWQ
TETGATMICPLPGVAATKPGAAMTPLPGISARIVDDHGDLVSPNDTGGEPVSGYLVIDAP
WPAMARGIWGDEQRFIETYWSRFAEQGWYFAGDGARYDADGDIWVLGRIDDVMNVSGHRI
STAEVESALVGHAAVAEAAVVGALDEQTGQRICAFVVLAASHSAAGGAIVDELRERVTVE
ISPIARPHKVHVVPELPKTRSGKIMRRLLRDVADGRELGDTSTLVDPSVFDAIRAAD
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggaaccctgacaccgcccccgcagactcgccgtcgtcgtacccaccgtccccc
gagttcaccgctcacgccaacaccggcgccgaggcctaccgtgcggccgaacacgaccgg
ctcgcgttctgggccgagcaggccaaccggctgcactgggcgacgccgttcaccgaggtg
ctcgactactcgcgggcgccgttcgcccgctggttcgccgacggcaggctcaacgtcgcc
tacaactgcgtggaccgccacgtggcggccggtcacggcgaccgggtggcgatccactgg
gcgggcgagccggccaacgacgcccgcaccatcacctatgcggagttgctcgccgaggtg
agccgggcggccaatgcgctgacgggccttggcctggtcgccggtgatcgggtcgccatc
tatctgccgatgatccccgaggcgatcatcgcgatgctggcctgtgcccggctgggggtg
ttgcacaccgtggtgttcgccggctactccgcgcacgcactgcgttcccgcatcgacgac
gcgcaggcgaagctggtgatcacctccgacggacagttccggcgcggccaggccgccccg
ctcaagcccgcggtcgacgaggcgttgagcgcagccgaagcgacaagcaccgtcgagcat
gtgctggtggtgcgccgcaccggtgccgaggttgcctggactcccgaccgcgacctgtgg
tggcacgacgtcgtcgacgccgcatcaccgcagcactcccccgaggcgttcgaggccgag
cagccgctgttcctgctctacacctcggggacgacgggcaagccgaagggcatcgtgcac
accagcggcggttacctgacccaggcggcctacacccactactgcgttttcgacctgaag
gcggccaccgacgtgttctggtgcaccgcagacatcgggtgggtcaccggccacacctat
gcggtgtacgggccgctggccaacggcgccaccgaggtgatctacgagggcacgccggac
ttcccggaccaacaccgccacttccagatcatcgaaaaatacggcgtgacaatctattac
accgcgccgacgctgatccgcacgttcatgaagtggggtcgcgacatccccgacgcccac
gacctgtcgagtctgcggctgctggggtcggtcggtgagccgatcaacccggaggcctgg
cgctggtatcgccgggtgatcggcgcggacgcggtgccggtggtcgacacctggtggcag
accgagaccggagcgacgatgatctgcccgctgcccggcgttgccgcgaccaaaccgggt
gccgcgatgaccccgctgcccgggatttcggcgcgcatcgtggacgaccacggtgatctg
gtgtccccgaacgacaccggcggcgaaccggtgtcgggatacctggtgatcgatgcgccg
tggccggcgatggcccgcggaatctggggggacgagcagcggttcatcgagacgtactgg
tcgcggttcgccgagcagggctggtacttcgccggtgacggcgcccgctatgacgccgac
ggtgacatctgggtgctcggccgtatcgacgacgtgatgaacgtgtccggacaccgcatc
tccaccgccgaggtggagtccgcgctggtcggtcacgccgcggtggccgaagccgccgtg
gtcggcgccctcgacgagcagaccgggcaacggatctgcgcgttcgtggtgctagcggcc
tcgcacagcgcggccggtggcgcgatcgtcgacgagctgcgcgagcgtgtcacggtcgag
atctcgccgatcgcccgcccgcacaaggtccacgttgtcccggagttgccgaagacccgc
agcggcaagatcatgcggcgactgctgcgcgacgtcgccgacggccgcgaactcggtgat
acctcaaccctggtggaccccagcgtgttcgacgcgatccgggcggccgactga

DBGET integrated database retrieval system