KEGG   Mycobacterium sp. JLS: Mjls_0165Help
Entry
Mjls_0165         CDS       T00482                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (GTP)
  KO
K01596  
phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mjls_0165
   00020 Citrate cycle (TCA cycle)
    Mjls_0165
   00620 Pyruvate metabolism
    Mjls_0165
Enzymes [BR:mjl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     Mjls_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
176061..177890
Genome map
AA seq 609 aa AA seqDB search
MTSATIPGLDTAPTEHEGLLAWVREVAELTQPDRVVFTDGSEEECARLTEQLCEAGTFQK
LNEEKKPNSYLALSDPSDVARVESRTYICSEREIDAGPTNNWMDPAEMRGIMTDLYRGSM
RGRTMYVVPFCMGPLEAEDPKLGVEITDSEYVVVSMRTMTRMGQAALDKMGTDGFFVKAL
HSLGAPLEPGEKDVPWPCNDTKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMA
HDEGWLAEHMLILKLISPENKAYFIAAAFPSACGKTNLAMLQPTIPGWRAETVGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWSSNPNAMKTIEAGNTVFTNVAKTDDGDVWWEGLE
GEPDHLIDWKGNDYILRETETKAAHPNSRYCTPISQCPTLAPEWDDPQGVPISAILFGGR
RKTTVPLITQARDWQHGVFIGATLGSEQTAAAEGKVGTVRRDPMAMLPFLGYNVGDYFQH
WIDIGKNADESKMPAVFFVNWFRRGDDGRFLWPGFGENSRVLKWAIERIEHKADGRSTPI
GIVPTAQDLDLEGLDVDPEDVDAALAVKPEEWRQELPLIEEWFEFVGEKLPTGIRDEFDA
LKHRLAEEA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagccaccattccgggtctggacaccgctccgaccgaacacgagggactgctg
gcctgggttcgggaggtcgccgagctgacccagcccgaccgggtggtgttcaccgacggt
tccgaggaggagtgcgcccggctgaccgagcagctgtgcgaggcgggcaccttccagaag
ctgaacgaggagaagaagccgaactcatacctggcactctccgacccctccgacgtggcg
cgcgtcgagtcgcgcacctatatctgctctgagcgtgagatcgacgccggtccgaccaac
aactggatggaccccgcggagatgcgcggcatcatgaccgacctgtaccgcggcagcatg
cgtggccgcaccatgtatgtggtgccgttctgcatgggtccgctcgaagccgaggacccc
aagctcggcgtggagatcaccgattcggagtacgtggtggtctcgatgcgcacgatgacc
cgcatgggtcaggcggccctcgacaagatgggcaccgacgggttcttcgtcaaggcgctg
cactccctcggtgcgccgctggagcccggtgagaaggacgtgccgtggccgtgcaacgac
accaagtacatcacccacttccccgagacccgcgagatctggagctacggatcgggttac
ggcggcaacgcgctgctcggcaagaagtgctactcgcttcggatcgcctcggcgatggcc
catgacgagggctggctcgccgagcacatgctgatcctcaagctcatctccccggagaac
aaggcctacttcatcgctgcggcgttcccgtcggcctgcgggaagaccaacctcgcgatg
ctgcagcccaccatcccgggctggcgcgccgagaccgtcggcgacgacatcgcgtggatg
cggttcggcaaggacgggcgcctgtacgccgtcaaccccgaattcggcttcttcggcgtc
gcccccggcacgaactggtcgtcgaacccgaacgcgatgaagaccatcgaggccggcaac
accgtcttcaccaacgtcgccaagaccgacgacggcgatgtgtggtgggaaggtctggag
ggtgagcccgaccacctgatcgactggaagggcaacgactacatcctgcgtgagacggaa
acgaaggccgcccacccgaactcgcgttactgcacgccgatctcccagtgcccgacgctg
gcgcccgagtgggatgatccgcagggcgtgccgatctcggccatcctgttcggcggccgc
cgcaagacgaccgtcccgctgatcacccaggcccgcgactggcagcacggcgtcttcatc
ggcgccaccctcggctcggagcagaccgccgccgccgagggcaaggtcggcacggtgcgt
cgcgatccgatggcgatgctgccgttcctcggctacaacgtcggcgactacttccagcac
tggatcgacatcggcaagaacgccgacgagtcgaagatgcccgcggtgttcttcgtgaac
tggttccgccgcggcgacgacggccgcttcctgtggccgggcttcggcgagaacagccgc
gtgctcaagtgggcgatcgagcgcatcgagcacaaggccgacggccgcagcacgccgatc
ggcatcgtgccgaccgcgcaggacctcgacctcgagggtctggatgtcgacccggaggac
gtcgacgccgcgctggcggtcaagcccgaggagtggcggcaggaactgccgctcatcgag
gagtggttcgagttcgtcggcgagaagctgcccacgggcatccgcgacgagttcgacgcg
ctcaagcaccgtctggccgaagaggcttaa

DBGET integrated database retrieval system