KEGG   Mycobacterium sp. JLS: Mjls_0176Help
Entry
Mjls_0176         CDS       T00482                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00630  Glyoxylate and dicarboxylate metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mjls_0176
Enzymes [BR:mjl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mjls_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABN95989
JGI: mjls0176
Position
complement(188748..191045)
Genome map
AA seq 765 aa AA seqDB search
MTTHAESKTGTSFDQEVAETQRYLDSPRFEGITRLYTARQVVEQRGTIPVDHTVAREAAT
AFYPRLRELFSQGKSITTFGPYSPGQAVTMKRAGIEGIYLGGWATSAKGSTDEDPGPDLA
SYPLSQVPDEAAGLVRALLTADRNQHYLRLRMSEEQRAAAPPPVDFRPFIIADADTGHGG
DPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMG
VPGIIVARTDAEAANLIDSRADERDQPFLLGATNLSIPSYKSCFLAMMRSFHDAGVTALN
GHLLYWLPDGEYETARAWLERHGIADVIAKAVEQWRSDGDPSNDALYDDVESQFIAAWEE
DAGLKTYAETVAARLEFAEGDGEAYAMGVDEWTQFAKRASLYTAGKKARELGVDVDWDCE
LAKTPEGYYQLRGGIPYAIAKQLAAAPFADILWMETKTADLADAREFAEAIHAEYPDKML
AYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFITYGGHQVDGVASEEFATALRQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALLASSGRTATTKAMGKGSTQHQHLVQT
EVPKKLLEDWLAMWSEHYQLGEKLRVQLRPRRAGGEVLELGIYGERDSGEEKLADVLVDP
IKDRYGRSILTVRDQNTYAEKLRKKRLMTLVHLWLVHRFKADAVYYVTPTDDNVYQTEKM
KSHGIFSDVHKDVGEIIVAEVNRARIEELLAPDREALGRLIRKED
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccacgctgaatccaagaccggcacgtcattcgaccaagaggtcgccgagacg
cagcgctatctcgacagcccccggttcgagggcatcacccgcctctacaccgcccgacag
gtcgtcgaacagcgcgggacgatccccgtcgaccacaccgtggcccgcgaggcggcgacg
gcgttctacccgcgccttcgcgaactgttctcccagggcaagagcatcacgaccttcggc
ccctactcccccgggcaggccgtgaccatgaaacgggccggcatcgagggcatctacctg
ggcggctgggccacctccgccaaggggtccaccgacgaggaccccggtcccgatctggcc
agctatccgctcagccaggtgcccgacgaagccgccggtctggtgcgcgcactgctcacc
gccgaccgcaaccagcactaccttcggctgcggatgagcgaggagcaacgggcggcagcg
ccgcctcccgtcgacttccggccgttcatcatcgccgacgccgacaccggacacggcggt
gatccccacgtgcgcaacctgattcgacggttcgtcgaggccggcgtgcccgggtaccac
atcgaggaccagcgccccggcaccaagaagtgcggacatcagggcggcaaggtcctggtg
ccgtcggacgagcagatcaaacgcctcaacaccgcccggttccaactcgacatcatgggc
gtaccgggcatcatcgtcgcccgcaccgacgccgaggccgccaacctgatcgacagccgc
gccgacgaacgcgatcaacccttcctgctcggcgcgacgaatctgtccattccgtcgtac
aagtcgtgcttcctggcgatgatgcgcagcttccacgacgcgggcgtcaccgcactcaac
ggccacctgctctactggctgcccgacggcgagtacgagaccgcgcgcgcctggctggaa
cgccacggtatcgccgacgtcatcgccaaggccgtcgagcagtggcgttccgacggcgac
ccgagcaacgacgcgctctacgacgacgtcgagtcgcagttcatcgcggcctgggaggag
gacgccgggctgaagacctacgccgagacggtggccgcccgcctcgagttcgccgagggt
gacggcgaggcgtacgcgatgggtgtcgacgagtggacgcagttcgccaagcgggcgtcg
ctgtacaccgccggcaagaaggccagggagttgggcgtcgacgtcgactgggactgtgag
ctggcgaagaccccggaggggtattaccaactgcgcggcggcattccgtacgcgatcgcc
aaacaactggccgccgcaccgttcgccgacatcctgtggatggagaccaagaccgccgac
ctcgccgacgccagggagttcgccgaggccatccacgccgagtacccggacaagatgctc
gcctacaacctgtcgccgtcgttcaactgggacaccaccggtatgaccgatgacgagatg
cgggcgttccccgaggaactcggcaagatgggcttcgtcttcaacttcatcacctacggc
ggacaccaggtcgacggggtggcctccgaggagttcgccaccgccctgcggcaggacggc
atgctcgcgctggcccgtctgcagcgcaagatgcggctcgtcgaatcgccctaccgcaca
ccgcagacgctcgtcggcgggccgcgcagcgacgccgccctgctcgcctcgtccggccgc
accgccaccaccaaggcgatgggcaagggctccacacagcatcagcacctggtgcagacc
gaggtgcccaagaagctgctcgaggactggctcgcgatgtggagtgagcactatcagctg
ggcgagaagttgcgggtgcagttgcggccccgtcgcgcgggcggtgaagtgctcgaactc
ggtatctacggggagcgcgacagcggcgaggagaaactcgccgacgtgctggtcgacccg
atcaaggaccggtacggccgcagcatcctcacggtgcgcgaccagaacacctatgccgag
aagctgcgcaagaagcggctgatgacgctggtccacctgtggctggtgcaccgattcaag
gccgacgcggtgtactacgtgacaccgaccgacgacaacgtctaccagaccgagaagatg
aagtcgcacggcatcttcagcgatgtgcacaaggacgtcggggagatcatcgtcgccgag
gtcaaccgcgcgcgcatcgaggagctgctggcccccgaccgggaggcgctcggccggctg
atccgcaaggaagactga

DBGET integrated database retrieval system