KEGG   Mycobacterium sp. JLS: Mjls_0176Help
Entry
Mjls_0176         CDS       T00482                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mjls_0176
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mjls_0176
Enzymes [BR:mjl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mjls_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(188748..191045)
Genome map
AA seq 765 aa AA seqDB search
MTTHAESKTGTSFDQEVAETQRYLDSPRFEGITRLYTARQVVEQRGTIPVDHTVAREAAT
AFYPRLRELFSQGKSITTFGPYSPGQAVTMKRAGIEGIYLGGWATSAKGSTDEDPGPDLA
SYPLSQVPDEAAGLVRALLTADRNQHYLRLRMSEEQRAAAPPPVDFRPFIIADADTGHGG
DPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMG
VPGIIVARTDAEAANLIDSRADERDQPFLLGATNLSIPSYKSCFLAMMRSFHDAGVTALN
GHLLYWLPDGEYETARAWLERHGIADVIAKAVEQWRSDGDPSNDALYDDVESQFIAAWEE
DAGLKTYAETVAARLEFAEGDGEAYAMGVDEWTQFAKRASLYTAGKKARELGVDVDWDCE
LAKTPEGYYQLRGGIPYAIAKQLAAAPFADILWMETKTADLADAREFAEAIHAEYPDKML
AYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFITYGGHQVDGVASEEFATALRQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALLASSGRTATTKAMGKGSTQHQHLVQT
EVPKKLLEDWLAMWSEHYQLGEKLRVQLRPRRAGGEVLELGIYGERDSGEEKLADVLVDP
IKDRYGRSILTVRDQNTYAEKLRKKRLMTLVHLWLVHRFKADAVYYVTPTDDNVYQTEKM
KSHGIFSDVHKDVGEIIVAEVNRARIEELLAPDREALGRLIRKED
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccacgctgaatccaagaccggcacgtcattcgaccaagaggtcgccgagacg
cagcgctatctcgacagcccccggttcgagggcatcacccgcctctacaccgcccgacag
gtcgtcgaacagcgcgggacgatccccgtcgaccacaccgtggcccgcgaggcggcgacg
gcgttctacccgcgccttcgcgaactgttctcccagggcaagagcatcacgaccttcggc
ccctactcccccgggcaggccgtgaccatgaaacgggccggcatcgagggcatctacctg
ggcggctgggccacctccgccaaggggtccaccgacgaggaccccggtcccgatctggcc
agctatccgctcagccaggtgcccgacgaagccgccggtctggtgcgcgcactgctcacc
gccgaccgcaaccagcactaccttcggctgcggatgagcgaggagcaacgggcggcagcg
ccgcctcccgtcgacttccggccgttcatcatcgccgacgccgacaccggacacggcggt
gatccccacgtgcgcaacctgattcgacggttcgtcgaggccggcgtgcccgggtaccac
atcgaggaccagcgccccggcaccaagaagtgcggacatcagggcggcaaggtcctggtg
ccgtcggacgagcagatcaaacgcctcaacaccgcccggttccaactcgacatcatgggc
gtaccgggcatcatcgtcgcccgcaccgacgccgaggccgccaacctgatcgacagccgc
gccgacgaacgcgatcaacccttcctgctcggcgcgacgaatctgtccattccgtcgtac
aagtcgtgcttcctggcgatgatgcgcagcttccacgacgcgggcgtcaccgcactcaac
ggccacctgctctactggctgcccgacggcgagtacgagaccgcgcgcgcctggctggaa
cgccacggtatcgccgacgtcatcgccaaggccgtcgagcagtggcgttccgacggcgac
ccgagcaacgacgcgctctacgacgacgtcgagtcgcagttcatcgcggcctgggaggag
gacgccgggctgaagacctacgccgagacggtggccgcccgcctcgagttcgccgagggt
gacggcgaggcgtacgcgatgggtgtcgacgagtggacgcagttcgccaagcgggcgtcg
ctgtacaccgccggcaagaaggccagggagttgggcgtcgacgtcgactgggactgtgag
ctggcgaagaccccggaggggtattaccaactgcgcggcggcattccgtacgcgatcgcc
aaacaactggccgccgcaccgttcgccgacatcctgtggatggagaccaagaccgccgac
ctcgccgacgccagggagttcgccgaggccatccacgccgagtacccggacaagatgctc
gcctacaacctgtcgccgtcgttcaactgggacaccaccggtatgaccgatgacgagatg
cgggcgttccccgaggaactcggcaagatgggcttcgtcttcaacttcatcacctacggc
ggacaccaggtcgacggggtggcctccgaggagttcgccaccgccctgcggcaggacggc
atgctcgcgctggcccgtctgcagcgcaagatgcggctcgtcgaatcgccctaccgcaca
ccgcagacgctcgtcggcgggccgcgcagcgacgccgccctgctcgcctcgtccggccgc
accgccaccaccaaggcgatgggcaagggctccacacagcatcagcacctggtgcagacc
gaggtgcccaagaagctgctcgaggactggctcgcgatgtggagtgagcactatcagctg
ggcgagaagttgcgggtgcagttgcggccccgtcgcgcgggcggtgaagtgctcgaactc
ggtatctacggggagcgcgacagcggcgaggagaaactcgccgacgtgctggtcgacccg
atcaaggaccggtacggccgcagcatcctcacggtgcgcgaccagaacacctatgccgag
aagctgcgcaagaagcggctgatgacgctggtccacctgtggctggtgcaccgattcaag
gccgacgcggtgtactacgtgacaccgaccgacgacaacgtctaccagaccgagaagatg
aagtcgcacggcatcttcagcgatgtgcacaaggacgtcggggagatcatcgtcgccgag
gtcaaccgcgcgcgcatcgaggagctgctggcccccgaccgggaggcgctcggccggctg
atccgcaaggaagactga

DBGET integrated database retrieval system