KEGG   Mycobacterium sp. JLS: Mjls_0219Help
Entry
Mjls_0219         CDS       T00482                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mjl  Mycobacterium sp. JLS
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mjl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mjl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
235699..236892
Genome map
AA seq 397 aa AA seqDB search
MAWTRGLCALVATSGMLLACSSPKQEPAAAPADPAITAAPVSAAPAVPLKAPVPLAPGAA
ACGQGAALLSEMTTRDKLAQLLMVGVTGAADARAVVDNHRIGGIMIGSWTDLSMMGAPLA
EIAASAGPLPLAVSVDEEGGRVSRLASLIGSQPSARALAQSSTPDQVYGIALERGRAMRG
LGVTIDFAPVVDVTGASAAIGDRSFGDDPATVTEYAGAYARGLRDAGVLPVLKHFPGHGN
ASGDSHTEGVVTPPLSELQNSDLVPYRTLTAQAPVGVMVGHMQVPGLTESDPASLSPAAY
QLLRSGGYGGPGFNGPVFTDDISSMRAITDRYGVADAALRALQAGADTALWVTTAEVPAV
LDRLEQAVGSGELTMPRVDQSVLRVAAMKGPNPRCGG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcttggacccgaggactgtgtgcactggtcgcgacgtcgggaatgctgctcgcgtgc
tcgtcgccgaagcaggaacccgcggccgcaccggccgatccggcgatcaccgccgccccc
gtctccgccgcccccgccgttccgctgaaggccccggtgccgctggcgcccggcgccgcg
gcatgcggtcagggcgccgcgctgctctcggagatgacgacccgcgacaagctggcccag
ctgctgatggtcggcgtcaccggcgccgccgacgcccgcgcggtggtcgacaaccaccgc
atcggcggcatcatgatcggcagttggaccgacctgtcgatgatgggcgccccgctggcc
gagatcgccgcctccgcgggcccgctgccgctggcggtcagcgtcgacgaggagggcggc
cgggtctcccggctggcttcactgatcggcagccaaccgtcggcgcgggcgctggcccag
agttcgacccccgaccaggtctacggcatcgcgctcgaacggggccgggcgatgcgcggt
ctcggcgtcacgatcgacttcgcgccggtcgtcgacgtcaccggggccagtgccgccatc
ggtgaccggtccttcggcgacgacccggcgacggtcaccgaatacgccggggcgtacgcc
cgcgggctgcgcgacgccggggtgctgccggtgctcaaacacttcccgggccacggcaac
gcctccggcgactcgcacaccgagggcgtcgtcaccccgccgctgtccgagctgcagaac
tccgacctcgtgccgtaccgcacgctgaccgcgcaggcgccggtcggggtgatggtcggc
cacatgcaggtgccgggactgaccgaaagcgatccggcgagcctgagcccggcggcctac
cagctgctgcggtcgggcggctacggcgggccggggttcaacggtccggtcttcaccgac
gacatctcgagcatgcgggcgatcaccgatcggtacggggtggccgatgcggcgctgcgc
gccctgcaggccggcgccgacaccgcgttgtgggtgacgacggccgaggtgcccgcggtg
ctcgaccggctcgaacaggcggtgggctccggtgagctgacgatgccgcgcgtcgaccag
tcggtgctgcgggtggcggcgatgaagggcccgaacccgcgctgcggcggctga

DBGET integrated database retrieval system