KEGG   Mycobacterium sp. JLS: Mjls_0219Help
Entry
Mjls_0219         CDS       T00482                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mjl  Mycobacterium sp. JLS
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mjls_0219
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mjls_0219
Enzymes [BR:mjl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mjls_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
235699..236892
Genome map
AA seq 397 aa AA seqDB search
MAWTRGLCALVATSGMLLACSSPKQEPAAAPADPAITAAPVSAAPAVPLKAPVPLAPGAA
ACGQGAALLSEMTTRDKLAQLLMVGVTGAADARAVVDNHRIGGIMIGSWTDLSMMGAPLA
EIAASAGPLPLAVSVDEEGGRVSRLASLIGSQPSARALAQSSTPDQVYGIALERGRAMRG
LGVTIDFAPVVDVTGASAAIGDRSFGDDPATVTEYAGAYARGLRDAGVLPVLKHFPGHGN
ASGDSHTEGVVTPPLSELQNSDLVPYRTLTAQAPVGVMVGHMQVPGLTESDPASLSPAAY
QLLRSGGYGGPGFNGPVFTDDISSMRAITDRYGVADAALRALQAGADTALWVTTAEVPAV
LDRLEQAVGSGELTMPRVDQSVLRVAAMKGPNPRCGG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcttggacccgaggactgtgtgcactggtcgcgacgtcgggaatgctgctcgcgtgc
tcgtcgccgaagcaggaacccgcggccgcaccggccgatccggcgatcaccgccgccccc
gtctccgccgcccccgccgttccgctgaaggccccggtgccgctggcgcccggcgccgcg
gcatgcggtcagggcgccgcgctgctctcggagatgacgacccgcgacaagctggcccag
ctgctgatggtcggcgtcaccggcgccgccgacgcccgcgcggtggtcgacaaccaccgc
atcggcggcatcatgatcggcagttggaccgacctgtcgatgatgggcgccccgctggcc
gagatcgccgcctccgcgggcccgctgccgctggcggtcagcgtcgacgaggagggcggc
cgggtctcccggctggcttcactgatcggcagccaaccgtcggcgcgggcgctggcccag
agttcgacccccgaccaggtctacggcatcgcgctcgaacggggccgggcgatgcgcggt
ctcggcgtcacgatcgacttcgcgccggtcgtcgacgtcaccggggccagtgccgccatc
ggtgaccggtccttcggcgacgacccggcgacggtcaccgaatacgccggggcgtacgcc
cgcgggctgcgcgacgccggggtgctgccggtgctcaaacacttcccgggccacggcaac
gcctccggcgactcgcacaccgagggcgtcgtcaccccgccgctgtccgagctgcagaac
tccgacctcgtgccgtaccgcacgctgaccgcgcaggcgccggtcggggtgatggtcggc
cacatgcaggtgccgggactgaccgaaagcgatccggcgagcctgagcccggcggcctac
cagctgctgcggtcgggcggctacggcgggccggggttcaacggtccggtcttcaccgac
gacatctcgagcatgcgggcgatcaccgatcggtacggggtggccgatgcggcgctgcgc
gccctgcaggccggcgccgacaccgcgttgtgggtgacgacggccgaggtgcccgcggtg
ctcgaccggctcgaacaggcggtgggctccggtgagctgacgatgccgcgcgtcgaccag
tcggtgctgcgggtggcggcgatgaagggcccgaacccgcgctgcggcggctga

DBGET integrated database retrieval system