KEGG   Mycobacterium sp. JLS: Mjls_0652Help
Entry
Mjls_0652         CDS       T00482                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mjls_0652
   01230 Biosynthesis of amino acids
    Mjls_0652
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mjls_0652
  Energy metabolism
   00680 Methane metabolism
    Mjls_0652
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mjls_0652
Enzymes [BR:mjl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mjls_0652
Exosome [BR:mjl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mjls_0652
  Exosomal proteins of melanoma cells
   Mjls_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
707211..707957
Genome map
AA seq 248 aa AA seqDB search
MGDSTLILLRHGESEWNAKNLFTGWVDVDLTDKGRAEATRAGELIADLDRLPDELYTSLL
RRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAETKEKYGEEQFMAWRRSYD
TPPPPIEAGSEYSQDRDPRYADIDGGPLTECLADVVARFVPYFEQTIVPDLREGKTVLIA
AHGNSLRALVKYLDGMSDEDVVGLNIPTGIPLRYDLDSDLKPTVAGGTYLDPEAAAAGAA
AVASQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggagattccacgctgatcctgcttcgtcacggcgaaagtgaatggaacgcgaagaac
ctgttcaccggctgggtcgacgtcgacctgaccgacaagggccgggccgaggccacgcgg
gccggtgagctgatcgccgatctggaccggttgcccgacgagctgtacacctcgctgctg
cggcgcgcgatcaccacggccaacatcgcgttggacaaggcggaccggcactggatcccg
gtgcaccgggactggcggctcaacgagcggcactacggggcgctgcaggggctgaacaag
gccgagaccaaagagaagtacggcgaagagcagttcatggcctggcggcgcagctacgac
accccgccgccgccgatcgaggccggcagcgagtacagccaggaccgcgatccccgctac
gccgacatcgacggcggaccgctcacagaatgcctggccgacgtggtggcccgcttcgtg
ccctacttcgagcagacgatcgtgccggatctgcgcgagggcaagaccgtgctgatcgca
gcgcacggcaactcactgcgtgcgctggtcaagtacctcgacggcatgtccgacgaggac
gtggtcgggctgaacatcccgaccggcataccgctgcgctacgacctggactccgatctg
aagccgacggtggcaggcggcacgtacctcgatccggaggccgcggcggccggcgcggcg
gccgtggcatcccagggcgcgaagtaa

DBGET integrated database retrieval system