KEGG   Mycobacterium sp. JLS: Mjls_0671Help
Entry
Mjls_0671         CDS       T00482                                 

Definition
uroporphyrinogen-III synthase / uroporphyrinogen-III C-methyltransferase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mjl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
722933..724597
Genome map
AA seq 554 aa AA seqDB search
MTRQESGRGRKMKPGRITFVGSGPGDPGLLTARAHSVLVNAALVFTDPDVPEAVLSLVGA
HLPPPSGPEPAEPADAADEQAGSTIPGGPDIRPALGDPAEVAKVLAGEAKHGVDVVRLVA
GDPLSVDAVIAEVNALAKSHANFEIVPGLPNTTAVPTYAGLPLGSTHTVADVRDPNVDWA
ALAAAPGPLILHATASHLPDAARTLIEYGLAETTPAVVTANGTTCQQRSVESTLFGLLDK
AALTAPDATGAPAAPLAGPLVVTLGRTVTNRARLNWWESRALYGWTVLVPRTKDQAGEMS
DKLVGHGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQWVVFTSTNAVRAVWEKFNEF
GLDARAFSGVKIACVGQATAERVRAFGINPELVPTGEQSSLGLLDEFPPYDDIFDPVNRV
LLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPASTREMIKTGGFDAVCFTSSST
VRNLVGIAGKPHARTIVACIGPKTAETAAEFGLRVDVQPEVAAVGPLVEALAEHAARLRA
EGALPPPRKKSRRR
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgactcggcaggagagcgggcgtgggcgcaagatgaagcccggccgcatcaccttcgtg
ggctcgggcccgggcgaccccggcctgttgaccgcacgggcccacagtgtgctcgtcaat
gccgcgctggtcttcaccgaccccgacgtccccgaggcggtgctgtccctggtgggcgcg
cacctgcccccaccgtcgggccctgaaccggccgagccggcggacgccgccgacgagcag
gcgggctcgaccatccccggcggcccggacatccggcccgcgctgggtgatccggccgag
gtggccaaggtcctggccggtgaggccaagcacggtgtggacgtggtccggctggtggcc
ggcgacccgctgtcggtcgacgccgtcatcgccgaggtgaacgcgctggccaagagccac
gccaacttcgagatcgtgcccggcctcccgaacaccaccgcggtcccgacgtacgccggc
ctgccgctggggtccacccacaccgtcgccgacgtgcgcgacccgaacgtggactgggcg
gccctggccgccgcgcccggcccgctgatcctgcacgcgaccgcctcgcatctgcccgac
gccgcgcgcacgctgatcgagtacggcctggccgagaccaccccggcggtggtcaccgcc
aacggcaccacctgccagcagcgctcggtcgagtcgacgctgttcgggctgctcgacaag
gccgcgctgaccgcaccggacgcgaccggtgcacccgccgcaccgctggccggcccgctg
gtcgtgacgctcggccgcaccgtcaccaaccgggcccgcctgaactggtgggagagccgc
gcactgtacggctggacggtgctggtgccgcggaccaaggatcaggccggggagatgagc
gacaagctcgtcggccacggcgccctgccgatcgaggtgcccaccatcgccgtcgaaccg
ccgcgcagccccgcgcagatggagcgtgcggtcaagggtctggtcgacggccggttccag
tgggtcgtgttcacctccaccaacgcggtgcgcgcggtgtgggagaagttcaacgagttc
gggctcgacgcccgcgcgttctccggtgtgaagatcgcctgcgtcggtcaggcgacggca
gagcgggtgcgcgcgttcgggatcaaccccgagctggttccgacgggggagcagtcctcg
ctgggtctgctcgacgagttcccgccgtacgacgacattttcgatccggtgaaccgggtg
ctgctgccgcgcgccgacatcgccaccgagacgctggccgaggggctgcgcgaacgcggt
tgggagatcgaggacgtcaccgcctaccggacggtgcgtgccgcaccgccgccggcctcg
acgcgcgagatgatcaagacgggcggcttcgacgcggtgtgcttcacgtcgagctcgacg
gtgcgcaacctggtcggcatcgccggtaagccgcacgcccgcacgatcgtcgcctgcatc
gggcccaagaccgcggagacggcagcggagttcggcctgcgcgtcgacgtgcagcccgag
gtggccgcggtcggtccgctggtggaggcgctcgccgagcacgccgcccgactgcgcgcc
gagggtgcgctgccgccgccgcgcaagaagagtcgccgccgctga

DBGET integrated database retrieval system