KEGG   Mycobacterium sp. JLS: Mjls_0672Help
Entry
Mjls_0672         CDS       T00482                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mjls_0672
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mjls_0672
Exosome [BR:mjl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mjls_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
724600..725571
Genome map
AA seq 323 aa AA seqDB search
MRQRPRRLRSTPAMRRLVAETSLEPRHLVLPMFVADGIDEPRPISSMPGVVQHTRDSLRR
AAADAVAAGVGGLMLFGVPRDEDKDPRGSIGMDPEGILNVALRDLAKDLGEDTVIMADTC
LDEFTDHGHCGVLDDRGRVDNDATNQQYVKLAVAQAQSGAHVVAPSGMMDGQVAAIRDGL
DGAGHTDVAILAYAAKFASAFYGPFREAVGSSLQGDRRTYQQDSGNAREALREIELDLAE
GADMVMVKPAMSYLDVVRACADISPVPVAAYQISGEYAMISAAAANGWIDLQASALEALT
GIRRAGADIVLTYWAADVAGWLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagcgtccgcgtaggttgcgttcgacaccggccatgcgtcggctggttgctgaa
acctccctggagccaaggcatctcgtgctgccgatgttcgtcgccgacgggatcgacgag
ccgcggccgatctcgtcgatgcccggggtggtgcaacacacccgcgactcgttgcgccgc
gcggccgccgacgcggtggccgccggggtgggcgggctgatgctgttcggggtgccccgc
gacgaggacaaggatccgcgcggttcgatcggcatggaccccgagggcatcctcaacgtc
gcgctgcgcgacctcgccaaggacctcggcgaggacaccgtgatcatggccgacacctgc
ctcgacgagttcaccgatcacggccactgcggggtgctggacgaccggggtcgggtcgac
aatgacgcgaccaatcagcagtacgtgaaacttgctgtggcccaggcgcagtcgggtgcc
cacgtggtcgcgccgagcgggatgatggacggtcaggtggccgccatccgcgacgggctg
gacggcgcaggacacaccgacgtggcgatcctggcgtatgcggccaagttcgcctcggcg
ttctacggcccgttccgcgaagccgtcggatcgagtctgcagggcgaccgccgcacctat
cagcaggacagcggcaacgcgcgcgaggctctgcgcgagatcgaactggacctcgccgag
ggcgccgacatggtgatggtgaagccggccatgtcctacctggacgtggtgcgcgcatgc
gccgacatctccccggtgccggtcgcggcgtaccagatctccggtgagtacgcgatgatc
agcgccgccgccgccaacggctggatcgatctgcaggcgtctgccctcgaagcgctcacc
ggtatccggcgggccggtgcggacatcgtgttgacctactgggcggccgacgtggccggc
tggctgggatga

DBGET integrated database retrieval system