KEGG   Mycobacterium sp. JLS: Mjls_0993Help
Entry
Mjls_0993         CDS       T00482                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mjls_0993
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mjls_0993
   00052 Galactose metabolism
    Mjls_0993
   00500 Starch and sucrose metabolism
    Mjls_0993
   00520 Amino sugar and nucleotide sugar metabolism
    Mjls_0993
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mjls_0993
   00524 Butirosin and neomycin biosynthesis
    Mjls_0993
Enzymes [BR:mjl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mjls_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1076161..1077069
Genome map
AA seq 302 aa AA seqDB search
MTDLTLALDIGGTKIAVGLVDADGTVVQRAQLPTPHSDAEAVWAVTSRLIAEAMSAGDGA
VRRAGIASAGPIDLPTGTVSPINLTVWQGFPIVSRVASLTGLPVRLGGDGLCMAMGERWR
GAARDAQFLLGMVVSTGVGGGLVLDGAPYDGRTGNAGHVGHVVVDPGGARCSCGGHGCVE
TVAAGPRMAQWARSQGWAAPPEADAKELADAALAGSEVALRAYARGARAVAAMIASVGAV
CDLDLVVIGGGVARSGALLFDPVRAALAEYAGLSFLRGLRVLPAELGGEAGLVGAAALAI
AG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgacgctggccctggacatcggcggcacgaagatcgccgtcggactcgtc
gacgccgacggcaccgtcgtgcagcgggcccagctgcccacgccgcacagcgacgccgag
gcggtgtgggcggtgacctcccggctgatcgccgaggcgatgtccgccggtgacggtgcg
gtgcgacgcgcgggtatcgcctcggccgggccgatcgacctgccgaccggcaccgtgagt
ccgatcaatctgactgtgtggcaaggctttccgatcgtctcccgggtcgcgtcgctgacc
ggtctgccggtgcgcctcggcggtgacgggctgtgcatggcgatgggtgagcggtggcgc
ggcgccgcgcgcgatgcgcagttcctgctgggcatggtggtgtcgaccggggtcggcggc
gggctggtgctcgacggcgccccttacgacgggcgcaccggcaacgcgggccacgtcggg
cacgtcgtcgtcgacccgggcggtgcgcggtgttcgtgcggtgggcacggctgcgtggag
accgtcgcggccggaccccggatggcgcagtgggcgcgctcgcagggatgggccgccccg
cccgaggccgacgccaaggaactggccgacgccgcgctcgccggatccgaggtcgcgctg
cgggcgtacgcgcgcggtgcgcgggccgtggcggcgatgatcgcgtccgtcggcgcggtg
tgcgacctcgatctggtggtgatcggcgggggagtggcgcggtcgggtgcgctgctgttc
gacccggtgcgggcggcgctggccgagtacgccgggctgagcttcctgcggggtctgcgg
gtgctgcccgccgaactgggcggtgaggccgggctggtcggcgccgcggcgctggcgatt
gccggatga

DBGET integrated database retrieval system