KEGG   Mycobacterium sp. JLS: Mjls_1194Help
Entry
Mjls_1194         CDS       T00482                                 

Definition
inosine 5'-monophosphate dehydrogenase (EC:1.1.1.205)
Orthology
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mjls_1194
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     Mjls_1194
Exosome [BR:mjl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mjls_1194
  Exosomal proteins of breast cancer cells
   Mjls_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1267538..1269091
Genome map
AA seq 517 aa AA seqDB search
MSIAERSVPIAVPVPTGGDDPTKVAMLGLTFDDVLLLPAASDVIPATADTSSQLTKRIRL
RVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVETVKRSEAGMVTDPVTC
SPDNTLAEVDAMCARFRISGLPVVDERGSLVGIITNRDMRFEVDQSKPVSEVMTKAPLIT
AQEGVSAEAALGLLRRHKIEKLPIVDGHGKLTGLITVKDFVKTEQFPLATKDSDGRLLVG
AAVGVGDDAWNRAMTLADAGVDVLIVDTAHAHNRSVLEMVHRIKTVLGDRVEVVGGNVAT
RAGAAALVEAGADAVKVGVGPGSICTTRVVAGVGAPQITAILESVAACAPAGVPVIADGG
LQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQFKSYRGMGSLGAMQGRGAT
GNLRGSFSKDRYFQDDVLSEDKLVPEGIEGRVPFRGPLAQVIHQLTGGLRAAMGYTGSPS
IEALQQAQFVQITAAGLKESHPHDITMTVEAPNYYAR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgctgaacgcagcgttcccatcgccgtaccggtgccgaccggcggcgacgat
ccgacgaaggtggccatgctcgggctgaccttcgacgacgtcctgctgctccccgccgcc
tccgacgtcatacccgcgacggccgacacctcgagccaactgaccaagcgcatccggctg
cgcgtgccgctggtcagctcggcgatggacacggtcaccgaatcccggatggccatcgcg
atggcccgcgccggcggcatgggtgtgctgcaccgcaacctgcccgtggccgaacaggcc
ggtcaggtcgaaaccgtcaaacggtccgaggccggtatggtcaccgacccggtgacctgc
tcaccggacaacacgctggccgaagtcgacgcgatgtgcgcgcggttccgcatctccggg
ctgccggtcgtggatgagcgcggctccctcgtcggcatcatcaccaaccgcgacatgcgc
ttcgaggtcgaccagtccaaaccggtctccgaggtgatgaccaaggcgcccctgatcacc
gcgcaggaaggtgtctcggccgaggccgcgctcggcctgctgcgccgccacaagatcgag
aagctgccgatcgtcgacgggcacggcaagctcaccgggctgatcaccgtcaaggacttc
gtcaagaccgaacagttcccgctggcgaccaaggactccgacggcaggctgctcgtcggc
gccgcggtcggcgtcggcgacgacgcgtggaaccgcgcgatgacgctggccgatgccggt
gtcgacgtgctgatcgtcgacaccgcccacgcccacaaccggtcggtgctcgagatggtg
caccgcatcaagaccgtgctcggtgaccgcgtcgaggtcgtcggcggcaacgtcgccacc
cgcgccggggccgccgcactcgtggaagccggcgcggacgccgtcaaggtcggtgtcggc
ccggggtcgatctgcaccacgcgggtcgtcgcgggcgtcggggcgccgcagatcaccgcg
atcctcgagtcggtcgccgcgtgcgccccggccggtgtgccggtgatcgccgacggcggc
ctgcagtactcgggtgacatcgccaaggcgctggccgcgggcgcgtcgacggccatgctg
ggctcgctgctcgcgggcaccgccgaggcgccgggcgagctgatcttcgtcaacggcaag
cagttcaagagctaccgcggcatgggatcgctcggtgcgatgcagggccgcggcgcgaca
ggcaacctccggggctccttctcgaaggaccgctacttccaggacgacgtgctctccgag
gacaagctggtacccgagggcatcgagggccgggtgccgttccgcggtccgctggcgcag
gtgatccaccagctcaccggcggtctgcgcgcggccatgggttacaccggttcaccctcc
atcgaggcgttgcagcaggcgcaattcgtgcagatcaccgcggcggggctgaaggaaagc
cacccgcacgacatcacgatgaccgtcgaagcgcccaactactacgcccgctga

DBGET integrated database retrieval system