KEGG   Mycobacterium sp. JLS: Mjls_1197Help
Entry
Mjls_1197         CDS       T00482                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Mjls_1197
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Mjls_1197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1271389..1273164
Genome map
AA seq 591 aa AA seqDB search
MQPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFADEDFAKTSWDLRNFLWAPQL
GCFGIQRIHLLRDVLILAGAGVGGGSLNYANTLYVPREPFFNDPQWKHITDWNEELLPHY
EQAQRMLGVVTNPTFTDADRVVKEVAEDMGVGDTFVPTPVGVFFGPDGQKTPGKTVPDPY
FGGVGPARRGCIEVGECMTGCRHNGKNTLVKNYLYLAERAGTEVHPLTTVTSFEQRADGV
WEVSTVRTGRKVRRQKRTFTANHVVLAAGTFGTQKLLFKMRDAGKLPELSDRLGMLTRTN
SESIVGAGKFEVTDDLDLTHGVAITSSIHPTSDTHIEPVRYGKGSNAMGLLQTLMTDGAG
PEGTDVPRWKQLFHNAKADPRGTMRLLNVRRWSERTLIALVMQNLDNSITTFTKRTKFGT
RRLTSKQGHGEPNPTWIPVGNEVTRRIAEKIDGVAGGTWGELFNIPLTAHFLGGAAIGDS
AEHGVIDPYHRVYNYPTLYVTDGAAISANLGVNPSLTISAQAERAASLWPNKGEEDLRPA
QGEGYRRLDPIRPAQPVVPAGAPAALDWNASREEVNRRDPTTAEASEARGA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgactacgacgtcctcatcatcggttcggggttcggtggcagcgtcaccgcg
ctgaggctcaccgagaagggctatcgggtcggcgtactcgaagcgggccgccgcttcgcc
gacgaggacttcgccaagacgtcgtgggatctgcggaacttcctgtgggcaccgcaactg
ggctgcttcggcatccagcgcatccatctgctccgcgatgtcctcatcctggccggcgcg
ggtgtcggcggcggatcgctcaactacgccaacaccctctacgtcccgcgcgagccgttc
ttcaacgacccgcagtggaagcacatcaccgactggaacgaagagctgctgccgcactac
gagcaggcccagcggatgctcggcgtggtcacgaacccgacgttcaccgacgccgaccgc
gtcgtgaaggaagtcgccgaggacatgggcgtcggcgacaccttcgtcccgacgccggtg
ggcgtgttcttcggaccggacgggcagaagaccccgggcaagacggtgcccgacccctac
ttcggcggtgtcggcccggcccgcaggggttgcatcgaggtcggcgaatgcatgacgggc
tgccgccacaacggcaagaacacgctggtgaagaactacctctacctcgccgagcgggcg
ggcaccgaggtacatccgctgaccaccgtgaccagcttcgaacagcgcgccgacggcgtc
tgggaggtgagcaccgtgcgcaccggccgcaaggtgcgccgccagaagcgcaccttcacc
gccaaccatgtcgtccttgcggcgggcacgttcggcactcagaagctgctgttcaagatg
cgtgacgccgggaagctccccgagctgtccgaccggctgggcatgctgacccggaccaac
tcggaatccatcgtcggcgccgggaaattcgaggtcaccgacgacctcgacctcacccac
ggcgtggcgatcacttcgtcgatccacccgacctccgacacccacatcgaaccggtgcgc
tacggcaagggctccaatgcgatggggctgctgcagacgctgatgaccgacggcgccggc
ccggagggcaccgacgtgccgcgctggaagcagctgttccacaacgccaaagcggatccg
cgcggcaccatgcgactgctcaacgtgcggcgctggagcgaacggacgctgatcgcgctg
gtcatgcagaacctcgacaactccatcaccaccttcaccaagcgcacgaagttcggcacc
cgccggctgacgagcaaacagggccacggtgagccgaacccgacgtggatcccggtgggc
aacgaggtgacgcggcggatcgccgagaagatcgacggcgtcgcgggcggcacctggggc
gaattgttcaacatccccctgacggcacacttcctcggcggcgccgccatcggcgacagc
gccgagcacggagtcatcgacccctaccaccgcgtctacaactatccgacgctgtacgtc
accgacggggcggcgatctcggccaacctcggcgtcaacccgtccctgaccatcagcgca
caggcggaacgggcggcctcgctgtggccgaacaagggcgaagaggatctgcgacccgca
cagggcgaggggtaccgccgcctggacccgatccgccctgcgcagcccgtggtgcccgcc
ggtgcgcccgcggccctggactggaacgccagccgcgaggaggtcaaccgccgcgacccc
accaccgccgaggcttccgaggcgcgcggcgcctga

DBGET integrated database retrieval system