KEGG   Mycobacterium sp. JLS: Mjls_1258Help
Entry
Mjls_1258         CDS       T00482                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mjls_1258 (deoA)
Enzymes [BR:mjl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mjls_1258 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1335034..1336353
Genome map
AA seq 439 aa AA seqDB search
MTDFTFDAPTVIRVKRDGGVLPDEAIDWVIDAYTRGQVADEQMSALLMAIFLRGMTGPEI
ARWTAAMVASGQRFDFTDLRRGGRPLALVDKHSTGGVGDKITIPLVPVVMACGGAVPQAA
GRGLGHTGGTLDKLEAIPGFTAELTKSQIRQQLSEIGAAIFAAGELAPADRKIYALRDVT
ATTESLPLIASSVMSKKIAEGARALVLDTKVGSGAFLPTEAEARELARTMVELGHAHGLV
TRALLTDMSVPLGRAVGNAVEVVESLEVLAGGGPDDVVELTLALAAEMLDAAGIDGTDPA
ETLRDGTAMDCFRALVAAQGGDTTRLAADALPIGVHTDTVTAPRGGTMGDIDAMAVGLAV
WRLGAGRSAPGEQVQFGAGLRIHRRPGEPVSAGEPLFTLYTDTPDRLGPARAELEGAWTV
GDSAPPARPLIIDRITATG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacttcactttcgatgctccgaccgtcatccgggtcaaacgcgacggcggcgtc
ctccccgacgaggcgatcgactgggtgatcgacgcgtacacccgcgggcaggtggccgac
gagcagatgtcggccctgctgatggcgatcttcctgcgcgggatgaccggccccgagatc
gcgcgctggaccgcggcgatggtggcctcggggcagcggttcgacttcaccgatctgcga
cgcggcggccgtccgctggcgctggtcgacaaacactccaccggtggggtcggcgacaag
atcaccatcccgctggtgcctgtcgtgatggcctgcggcggtgcggtgccccaggccgcc
ggacgcgggctcggccacaccggcggcaccctcgacaaactcgaagccatccccggattc
accgccgaactgaccaaaagccagatccgccaacaactcagcgagatcggtgcggcgatc
ttcgccgcgggtgagctggccccggccgaccgcaagatctacgcgctgcgcgacgtcacc
gccaccaccgaatcgctgccgctgatcgccagctcggtgatgagcaagaagatcgccgag
ggcgcccgcgcactggtgctcgacacgaaggtcggttcgggcgccttcctgcccaccgag
gccgaggcccgcgaactggcccgcacgatggtcgagttgggtcacgcgcacggtctggtg
acgcgcgccctgctgaccgacatgtcggtgccgctgggccgcgccgtcggcaacgcggtc
gaggtcgtcgaatccctggaggtgctcgccggcggcgggcccgacgacgtggtggaactg
acgctggcactggcggccgagatgctcgacgccgccgggatcgacggcaccgaccccgcc
gagacgctgcgcgacggtaccgccatggactgtttccgcgcgctcgtcgcggcccagggc
ggcgacaccacccgattggccgccgacgcgttgcccatcggtgtccacaccgacaccgtc
acggcaccgcgcggtggcaccatgggtgacatcgacgcgatggcggtgggtctggcggtg
tggcggctcggagcgggccgctcggcgcccggtgagcaggtgcagttcggcgccggcctc
cgcatccaccgccgtcccggtgagccggtgagtgcgggcgagccgctgttcaccctctac
accgacacccccgaccggctcgggccggcccgcgccgaactcgagggtgcctggacggtg
ggggacagcgccccgccggcgcgtccgctgatcatcgatcggatcaccgcgacaggctga

DBGET integrated database retrieval system