KEGG   Mycobacterium sp. JLS: Mjls_1848Help
Entry
Mjls_1848         CDS       T00482                                 

Definition
(GenBank) (1->4)-alpha-D-glucan branching enzyme
  KO
K16149  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00500  Starch and sucrose metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mjls_1848
Enzymes [BR:mjl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mjls_1848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 DUF1957
Motif
Other DBs
NCBI-ProteinID: ABN97636
JGI: mjls1848
Position
complement(1952627..1954192)
Genome map
AA seq 521 aa AA seqDB search
MSDDARVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSASYLPLTRVLRRLAGEGRDH
LLTLGMTPVVTAQLDDPYCLTGMHSWLANWQLRALEAATLRASSDTTPACTPEALRAFGV
REQGEAELALEEFATLWRHGGSPLLRELVDAGTVELLGGPLAHPFQPLLNPRLREFALRE
GLADAGQRFAHTPRGIWAPECAYAPGMEADYAAAGVGHFMVDGPSLHGDTALGRPVGHSG
VVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHVTGLKPARVTGRNVPSSAKAPYEPD
RADAAIDAHVADFVQVVRRRLTDESERIGRPAHVVAAFDTELFGHWWYEGPEWLARVLRA
LPEAGVRVGTLSDAVDGGFVGAPVDLPPSSWGSGKDWQVWAGDQVTDFVRLNAEVVDTAL
STVDKALTQRASVGSPTPRDTVADQILRETLLTVSSDWPFMVSKDSAADYARYRAHLHAH
ATREIADALAAGRREQAQRLADGWNRADGLFGALDARRLPR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgacgctcgggtaccggggctgttcaccctcgtcctgcacacgcatctgccg
tggctggcgcaccacggccgctggccggtcggcgaggagtggctctaccagtcgtggtcg
gcgtcgtacctgccgctgacgcgcgtgctgcgcaggctggccggcgagggccgcgaccat
ctgctcaccctcgggatgacaccggtggtgaccgctcagctcgacgacccctactgcctg
accgggatgcacagctggctggcgaactggcagctgcgggcactggaggccgccaccctg
cgcgcctcctcggacaccacaccggcgtgcacaccggaagcgttgcgcgccttcggtgtt
cgcgagcagggcgaggcggagctggcgctcgaggagttcgccacactgtggcgccacggc
ggcagtccgctgctgcgtgagctcgtcgacgcgggcaccgtcgaactgctgggcgggccg
ctggcgcatccgttccagccgttgctcaacccccgactgcgggagttcgcgctgcgcgaa
gggctcgccgacgccggacagcgcttcgcgcacaccccgcgcggcatctgggccccggag
tgcgcgtacgccccgggcatggaggccgactatgccgcggcgggcgtcggccacttcatg
gtcgacggcccgtcgctgcacggcgacaccgcgctcggccgccccgtcggccactccggc
gtcgtcgcgttcggtcgcgacctgcaggtcagctaccgcgtgtggtcgcccaagtccggc
tatcccggccacgccgcctaccgcgacttccacacctacgaccacgtcaccgggttgaag
ccggcgcgggtcaccgggcgcaacgtgccgtcgtcggccaaagccccatacgaaccggac
cgcgccgacgccgccatcgacgcccacgtcgccgacttcgtgcaggtggtgcggcggcgg
ctgacggacgagagcgagcggatcggccgcccggcgcacgtggtcgccgccttcgacacc
gaactgttcggccactggtggtacgaggggccggagtggctggcccgcgtactgcgggcg
ctgccggaagccggtgtgcgggtgggcacgctcagcgatgccgtcgacggcggattcgtc
ggcgccccagtcgatctgccgcccagttcgtggggttcgggtaaggactggcaggtctgg
gccggagaccaggtgaccgacttcgtccgactcaacgccgaggtcgtcgacaccgcgctc
agcaccgtcgacaaggcgctcacccagcgcgcgtcggtgggcagcccgacaccgcgggac
accgtcgccgaccagatcctgcgcgagaccctgctgaccgtctcgagcgactggccgttc
atggtgagcaaggactccgcggccgactacgcccgctaccgcgcccacctgcacgcccac
gcgacccgcgagatcgccgacgcactcgcggccggccggcgggagcaggcccagcgcctc
gccgacggctggaaccgcgccgacggcctgttcggcgccctcgacgcccgccggttaccg
cgatga

DBGET integrated database retrieval system