KEGG   Mycobacterium sp. JLS: Mjls_1848Help
Entry
Mjls_1848         CDS       T00482                                 

Definition
glycoside hydrolase family protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mjls_1848
Enzymes [BR:mjl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mjls_1848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1952627..1954192)
Genome map
AA seq 521 aa AA seqDB search
MSDDARVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSASYLPLTRVLRRLAGEGRDH
LLTLGMTPVVTAQLDDPYCLTGMHSWLANWQLRALEAATLRASSDTTPACTPEALRAFGV
REQGEAELALEEFATLWRHGGSPLLRELVDAGTVELLGGPLAHPFQPLLNPRLREFALRE
GLADAGQRFAHTPRGIWAPECAYAPGMEADYAAAGVGHFMVDGPSLHGDTALGRPVGHSG
VVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHVTGLKPARVTGRNVPSSAKAPYEPD
RADAAIDAHVADFVQVVRRRLTDESERIGRPAHVVAAFDTELFGHWWYEGPEWLARVLRA
LPEAGVRVGTLSDAVDGGFVGAPVDLPPSSWGSGKDWQVWAGDQVTDFVRLNAEVVDTAL
STVDKALTQRASVGSPTPRDTVADQILRETLLTVSSDWPFMVSKDSAADYARYRAHLHAH
ATREIADALAAGRREQAQRLADGWNRADGLFGALDARRLPR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgacgctcgggtaccggggctgttcaccctcgtcctgcacacgcatctgccg
tggctggcgcaccacggccgctggccggtcggcgaggagtggctctaccagtcgtggtcg
gcgtcgtacctgccgctgacgcgcgtgctgcgcaggctggccggcgagggccgcgaccat
ctgctcaccctcgggatgacaccggtggtgaccgctcagctcgacgacccctactgcctg
accgggatgcacagctggctggcgaactggcagctgcgggcactggaggccgccaccctg
cgcgcctcctcggacaccacaccggcgtgcacaccggaagcgttgcgcgccttcggtgtt
cgcgagcagggcgaggcggagctggcgctcgaggagttcgccacactgtggcgccacggc
ggcagtccgctgctgcgtgagctcgtcgacgcgggcaccgtcgaactgctgggcgggccg
ctggcgcatccgttccagccgttgctcaacccccgactgcgggagttcgcgctgcgcgaa
gggctcgccgacgccggacagcgcttcgcgcacaccccgcgcggcatctgggccccggag
tgcgcgtacgccccgggcatggaggccgactatgccgcggcgggcgtcggccacttcatg
gtcgacggcccgtcgctgcacggcgacaccgcgctcggccgccccgtcggccactccggc
gtcgtcgcgttcggtcgcgacctgcaggtcagctaccgcgtgtggtcgcccaagtccggc
tatcccggccacgccgcctaccgcgacttccacacctacgaccacgtcaccgggttgaag
ccggcgcgggtcaccgggcgcaacgtgccgtcgtcggccaaagccccatacgaaccggac
cgcgccgacgccgccatcgacgcccacgtcgccgacttcgtgcaggtggtgcggcggcgg
ctgacggacgagagcgagcggatcggccgcccggcgcacgtggtcgccgccttcgacacc
gaactgttcggccactggtggtacgaggggccggagtggctggcccgcgtactgcgggcg
ctgccggaagccggtgtgcgggtgggcacgctcagcgatgccgtcgacggcggattcgtc
ggcgccccagtcgatctgccgcccagttcgtggggttcgggtaaggactggcaggtctgg
gccggagaccaggtgaccgacttcgtccgactcaacgccgaggtcgtcgacaccgcgctc
agcaccgtcgacaaggcgctcacccagcgcgcgtcggtgggcagcccgacaccgcgggac
accgtcgccgaccagatcctgcgcgagaccctgctgaccgtctcgagcgactggccgttc
atggtgagcaaggactccgcggccgactacgcccgctaccgcgcccacctgcacgcccac
gcgacccgcgagatcgccgacgcactcgcggccggccggcgggagcaggcccagcgcctc
gccgacggctggaaccgcgccgacggcctgttcggcgccctcgacgcccgccggttaccg
cgatga

DBGET integrated database retrieval system