KEGG   Mycobacterium sp. JLS: Mjls_2175Help
Entry
Mjls_2175         CDS       T00482                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00010  Glycolysis / Gluconeogenesis
mjl00520  Amino sugar and nucleotide sugar metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01130  Biosynthesis of antibiotics
mjl01200  Carbon metabolism
Module
mjl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mjl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mjls_2175
   00520 Amino sugar and nucleotide sugar metabolism
    Mjls_2175
Enzymes [BR:mjl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mjls_2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABN97961
JGI: mjls2175
Position
complement(2272881..2273690)
Genome map
AA seq 269 aa AA seqDB search
MTATDSPVADPDAAGGDARRGFGIDVGGSGVKGGVVDLDTGQLIGERFKLPTPQPATPDA
VAKTIAAVVKEFGWTGKLGVTYPGVVTHGVVHTAANVDKSWLGVNAQEIYSAALDGQPVT
VLNDADAAGLAEERFGAGRDNTGVIVLLTFGTGIGSAVIHNGILLPNTEFGHLEVGGKEA
EHRAASSVKERKDWSYERWTQEVTKVLVAIENAIWPDLFIAGGGISRKADKWVPLLKNRT
PVVAAALQNSAGIVGAAMAAEVDVSATNR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgattcgcccgtcgcagatccggacgccgccggtggggacgcgcgtcgc
ggattcggtatcgacgtcgggggcagcggcgtcaagggcggcgtcgtcgacctggacacc
ggtcaactgatcggcgagcggttcaaactccccaccccgcagcccgccacccccgacgcc
gtcgccaagaccatcgccgcggtggtcaaggagttcggctggaccggaaagctcggcgtc
acctatcccggcgtggtgacccacggggtcgtgcacaccgccgcgaacgtcgacaagtcg
tggctgggcgtcaacgcccaggagatctacagcgccgccctcgacggtcagccggtcacg
gtgctcaacgacgccgacgcggcggggctggccgaggagcgtttcggcgcgggccgcgac
aacaccggcgtcatcgtgttgctgaccttcggcaccggtatcggctcggcggtcatccac
aacggcatcctgctgcccaacaccgaattcggtcatctggaggtgggcggcaaggaagcc
gagcaccgcgccgcgtcgtcggtcaaggagcgcaaggactggagttacgagcgctggacc
caggaggtcaccaaggtcctcgtggcgatcgagaacgcgatctggcccgacctgttcatc
gccggaggcggtatcagccgcaaggccgacaagtgggtgccgctgctgaagaaccgcacg
ccggtcgtggccgccgcgctgcagaactccgccggaatcgtcggcgcggcgatggccgct
gaggtggacgtctcagctaccaaccggtaa

DBGET integrated database retrieval system