KEGG   Mycobacterium sp. JLS: Mjls_2295Help
Entry
Mjls_2295         CDS       T00482                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mjl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2393777..2394736
Genome map
AA seq 319 aa AA seqDB search
MNLDNGRAIVGPADPQVQPRYAGWTTFARLPRLEDVSHADVVVVGVPFDSAVTYRPGARF
GPNAIRQGSRLIRGYNPELDVKPFEVCQFADAGDLACNPFDIAEAVDQVAEQLSQLLANG
TRAVILGGDHSVALPSLRAAHSVHGPMALVHFDAHLDTWDRYYGADITHGSPFRRAYEEG
LLLDRNMHVGVRGSIYDKQDLVDDANFGFSVVTCRDIGTLGAEGIVDKIRARVGDAPVYV
SVDIDVLDPAHAPGTGTPEAGGMTSRELLEVVRGLDSVNLVGVDVVEVSPAYDHAEITAI
AAANVTWEFLSVFGRKAQR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgacaacggccgcgcgatcgtcgggccggccgacccgcaggtgcagccccgt
tacgccggctggaccaccttcgcccggctgccacggctggaggacgtgtcccacgccgac
gtggtcgtggtgggtgtcccgttcgacagtgcggtcacctaccggccgggggcgcgcttc
ggccccaacgcgatacggcagggctcgcgcctgatccgcggctacaaccccgaactggac
gtcaaaccgttcgaggtctgccagttcgccgacgcgggggacctcgcatgcaatccgttc
gacatcgccgaggcggtcgaccaggtcgccgagcagttgagccaactgctcgccaacggc
acccgagcggtcatcctgggcggtgaccattcggtggcgctgccgtcgcttcgcgccgcc
cactccgtccacgggccgatggcgctggtgcacttcgatgcccacctcgacacctgggac
cgctactacggtgccgacatcacccacgggtcaccgttccggcgggcctacgaagaaggg
ctgctgctcgaccggaacatgcacgtcggggtccgcggatctatctacgacaaacaggat
ctcgtcgacgacgccaacttcggcttctccgtcgtcacctgccgcgacatcggcacgctg
ggcgccgagggcatcgtcgacaagatccgcgcccgcgtcggcgacgcgccggtctacgtc
tcggtcgacatcgacgtcctcgaccccgcccacgcgccgggtaccgggacgccggaggcc
ggcggcatgaccagccgcgaactgctcgaggtggtgcgcggtctggacagtgtgaacctg
gtcggcgtcgacgtcgtcgaggtctcacccgcctacgatcacgccgagatcaccgcgatc
gccgcggcgaacgtgacgtgggaattcctgtccgtcttcggaagaaaggctcaacgatga

DBGET integrated database retrieval system