KEGG   Mycobacterium sp. JLS: Mjls_2404Help
Entry
Mjls_2404         CDS       T00482                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00240  Pyrimidine metabolism
mjl00250  Alanine, aspartate and glutamate metabolism
mjl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mjls_2404
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mjls_2404
Enzymes [BR:mjl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mjls_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Keratin
Motif
Other DBs
NCBI-ProteinID: ABN98188
JGI: mjls2404
UniProt: A3PZ61
Position
2511114..2512064
Genome map
AA seq 316 aa AA seqDB search
MTRHLLTAADLSRDEATAILDDADRFSQALLGREVKKLPTLRGRTVITMFYENSTRTRVS
FEVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAAGADALIIRHPASGAAQQLAEWT
AAEAGAPSVINAGDGTHEHPTQALLDALTLRQRLGGIEGRRVVIVGDVLHSRVARSNVLL
LHTLGAEVVLVAPPTLLPVGVRQWPVTVSHDLDAELPAADAVLMLRVQAERMNGGFFPSA
REYSVRYGLSDKRQALLPDSAVVLHPGPMLRGMEISSSVADSSQSAVLQQVSNGVHVRMA
VLFHLLVGAEQEAISA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgacatctgttgaccgcggccgacctgagccgcgacgaggccaccgcgatcctc
gacgacgccgaccggttcagccaggcgctgctcggccgcgaggtcaagaagctgccgacg
ctgcgcgggcgcacggtgatcacgatgttctacgagaacagcacccgcacccgggtctcg
ttcgaggtcgcgggcaagtggatgagtgccgacgtgatcaacgtcagcgcgtccggttcc
tcggtggccaagggggagtcgttgcgcgacaccgcgctcacgttgcgcgccgcgggcgcc
gacgcgctgatcatccggcatcccgcgtccggcgccgcccagcaactcgcggagtggacg
gccgccgaggcgggcgcccccagcgtgatcaacgccggcgacggcacccacgaacacccc
acccaggcgttgctcgacgcgctgaccctgcgccagcggctcggcggcatcgagggcagg
cgggtggtgatcgtcggcgacgtactgcacagccgcgtggcccgatccaacgtgctgctc
ctgcacaccctgggcgcggaggtggtgctggtggcgccgccgaccctgctcccggtgggt
gtgcgccagtggccggtgacggtgtcgcacgacctggacgccgaactgcccgccgccgac
gcggtgctcatgctgcgggtgcaggccgagcggatgaacggcgggttcttcccgtcggcg
cgcgagtactcagtgcgctacggcctgtccgacaagcgtcaggcgttgctgcccgattcc
gcggtggtgctgcacccggggccgatgctgcgcggtatggagatctcctcgtcggtggcc
gactcgtcgcaatcggctgtgctgcaacaggtttccaatggtgtgcacgtccggatggcg
gtgctcttccatctgctcgtcggcgcggaacaggaggcgatcagcgcatga

DBGET integrated database retrieval system